![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc001190.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 118aa MW: 13207.5 Da PI: 10.8006 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.2 | 2.2e-28 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRrng+lKKA+EL +LCdaev viifsstgkly+y+s Itr_sc001190.1_g00001.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELGILCDAEVGVIIFSSTGKLYDYAS 59 8***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 4.2E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.3 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.06E-29 | 2 | 83 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.04E-37 | 2 | 60 | No hit | No description |
PRINTS | PR00404 | 8.8E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.8E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.8E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELGILCD AEVGVIIFSS TGKLYDYASS 60 RHRNSVVHAA PKNFEITLKY SMVKLAANDL FGKMVKKEVP SLGSEVQARK CVVYLFLN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 5e-19 | 1 | 60 | 1 | 60 | MEF2C |
5f28_B | 5e-19 | 1 | 60 | 1 | 60 | MEF2C |
5f28_C | 5e-19 | 1 | 60 | 1 | 60 | MEF2C |
5f28_D | 5e-19 | 1 | 60 | 1 | 60 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269|PubMed:15667327, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019175061.1 | 4e-35 | PREDICTED: MADS-box transcription factor 23-like isoform X1 | ||||
Refseq | XP_019175062.1 | 4e-35 | PREDICTED: MADS-box transcription factor 23-like isoform X1 | ||||
Refseq | XP_019175063.1 | 4e-35 | PREDICTED: MADS-box transcription factor 23-like isoform X2 | ||||
Swissprot | Q9SI38 | 2e-33 | ANR1_ARATH; MADS-box transcription factor ANR1 | ||||
TrEMBL | A0A0L9UYB2 | 6e-35 | A0A0L9UYB2_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A218W599 | 4e-35 | A0A218W599_PUNGR; Uncharacterized protein | ||||
TrEMBL | A0A314Z9N9 | 1e-34 | A0A314Z9N9_PRUYE; MADS-box protein 12 | ||||
STRING | cassava4.1_032220m | 5e-34 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G14210.1 | 8e-36 | AGAMOUS-like 44 |
Publications ? help Back to Top | |||
---|---|---|---|
|