PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

M-type_MADS

Protein Properties

Length: 99aa MW: 11431.4 Da PI: 10.5289

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc001131.1_g00002.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	82	3.9e-26	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien rqvtf+kRr+g+lKKA+ELSvLCdae+ v ifs +gklye + Itr_sc001131.1_g00002.1 9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGVFIFSAHGKLYELA 58 79*********************************************965 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	6.7E-36	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.06E-26	1	61	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.73	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.56E-36	2	61	No hit	No description
PRINTS	PR00404	2.2E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.1E-23	10	56	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-27	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
MARGKIQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGVFIFSA HGKLYELATQ 60 GQRLVRIKSS TMWLGDYWTE ADKGHVQHHV VKRLLDGDW

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	7e-17	1	85	1	76	MEF2C
5f28_B	7e-17	1	85	1	76	MEF2C
5f28_C	7e-17	1	85	1	76	MEF2C
5f28_D	7e-17	1	85	1	76	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269\|PubMed:18203871}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin in root phloem. {ECO:0000269\|PubMed:18203871}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019151822.1	2e-36	PREDICTED: agamous-like MADS-box protein AGL12
Refseq	XP_023522415.1	6e-37	agamous-like MADS-box protein AGL12, partial
Swissprot	Q38841	3e-33	AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBL	A0A438H0X0	1e-35	A0A438H0X0_VITVI; Agamous-like MADS-box protein AGL12
STRING	PGSC0003DMT400048352	2e-36	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G71692.1	1e-35	AGAMOUS-like 12

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Pacheco-Escobedo MA, et al. Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm. Ann. Bot., 2018. [PMID:27358290] García-Cruz KV, et al. The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components. Ann. Bot., 2018. [PMID:27474508]