PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc001065.1_g00001.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

M-type_MADS

Protein Properties

Length: 70aa MW: 8058.47 Da PI: 10.5908

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc001065.1_g00001.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	103.8	5.9e-33	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s Itr_sc001065.1_g00001.1 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.726	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.0E-42	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.60E-40	2	61	No hit	No description
SuperFamily	SSF55455	4.71E-32	2	65	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.1E-34	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.4E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.1E-34	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.1E-34	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 70 aa Download sequence Send to blast
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS 60 SRHPTLPYSL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	4e-21	1	66	1	66	MEF2C
5f28_B	4e-21	1	66	1	66	MEF2C
5f28_C	4e-21	1	66	1	66	MEF2C
5f28_D	4e-21	1	66	1	66	MEF2C
6byy_A	4e-21	1	66	1	66	MEF2 CHIMERA
6byy_B	4e-21	1	66	1	66	MEF2 CHIMERA
6byy_C	4e-21	1	66	1	66	MEF2 CHIMERA
6byy_D	4e-21	1	66	1	66	MEF2 CHIMERA
6bz1_A	4e-21	1	66	1	66	MEF2 CHIMERA
6bz1_B	4e-21	1	66	1	66	MEF2 CHIMERA
6bz1_C	4e-21	1	66	1	66	MEF2 CHIMERA
6bz1_D	4e-21	1	66	1	66	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor involved in flower development. {ECO:0000250\|UniProtKB:Q0HA25}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028059218.1	2e-37	MADS-box protein EJ2-like
Swissprot	Q03489	2e-36	AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
Swissprot	Q8LLR0	2e-36	MADS4_VITVI; Agamous-like MADS-box protein MADS4
TrEMBL	A0A438DXH4	2e-37	A0A438DXH4_VITVI; Agamous-like MADS-box protein AGL9-like
STRING	POPTR_0003s16800.1	2e-37	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	7e-39	MIKC_MADS family protein

Publications ? help Back to Top
Immink RG,Gadella TW,Ferrario S,Busscher M,Angenent GC Analysis of MADS box protein-protein interactions in living plant cells. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(4): p. 2416-21 [PMID:11854533] Immink RG, et al. Analysis of the petunia MADS-box transcription factor family. Mol. Genet. Genomics, 2003. 268(5): p. 598-606 [PMID:12589434] Angenent GC,Busscher M,Franken J,Mol JN,van Tunen AJ Differential expression of two MADS box genes in wild-type and mutant petunia flowers. Plant Cell, 1992. 4(8): p. 983-93 [PMID:1356537] Tonaco IA,Borst JW,de Vries SC,Angenent GC,Immink RG In vivo imaging of MADS-box transcription factor interactions. J. Exp. Bot., 2006. 57(1): p. 33-42 [PMID:16291798] Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751]