PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

Gene Ontology |

Function |

Orthologous Group |

Publication

Basic Information? help Back to Top

TF ID

Itr_sc000653.1_g00001.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

MYB_related

Protein Properties

Length: 59aa MW: 6472.54 Da PI: 5.6274

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc000653.1_g00001.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	34.6	4.5e-11	14	45	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT++Ed++lv +v+q+G g+W + +++ g Itr_sc000653.1_g00001.1 14 KGPWTPDEDQKLVAYVQQYGHGSWLALPSKAG 45 79**********************88777766 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	7.9E-13	5	43	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.65E-9	7	43	IPR009057	Homeodomain-like
PROSITE profile	PS51294	9.414	9	59	IPR017930	Myb domain
Pfam	PF00249	1.4E-8	14	43	IPR001005	SANT/Myb domain
CDD	cd00167	9.92E-7	16	37	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
MGSSACCENV GLKKGPWTPD EDQKLVAYVQ QYGHGSWLAL PSKAGILYII LSFFLLVDI

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269\|PubMed:17376813, ECO:0000269\|PubMed:23709630, ECO:0000269\|PubMed:24169067}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019170538.1	2e-23	PREDICTED: transcription factor MYB39-like
Swissprot	Q9LXF1	2e-20	MYB16_ARATH; Transcription factor MYB16
TrEMBL	A0A1S2Z8L5	3e-20	A0A1S2Z8L5_CICAR; transcription factor MYB106-like
TrEMBL	A9P0V4	1e-20	A9P0V4_PICSI; Uncharacterized protein
STRING	XP_004517012.1	5e-21	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G15310.2	8e-23	myb domain protein 16

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang BH, et al. Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae). Int J Mol Sci, 2015. 16(3): p. 5900-21 [PMID:25782156] Cui F, et al. Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation. Mol Plant, 2016. 9(6): p. 926-38 [PMID:27060495]