![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc000449.1_g00012.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 180aa MW: 19793.8 Da PI: 5.2923 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 159.7 | 4.4e-50 | 20 | 115 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 ++q+ +lPianv+rimk+ lP nakisk+aket+qec+sefi+fvt+easdkc+re+rkt+ngdd++wal+tlGf+dyv plk yl Itr_sc000449.1_g00012.1 20 QDQQLLLPIANVGRIMKQRLPHNAKISKEAKETMQECASEFIGFVTGEASDKCRRERRKTVNGDDICWALGTLGFDDYVGPLKRYL 105 5677899******************************************************************************* PP NF-YB 88 kkyrelegek 97 + +re eg++ Itr_sc000449.1_g00012.1 106 HIFREQEGDQ 115 *******997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.8E-48 | 17 | 133 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.71E-38 | 22 | 134 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.1E-25 | 26 | 89 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.7E-14 | 53 | 71 | No hit | No description |
PRINTS | PR00615 | 8.7E-14 | 72 | 90 | No hit | No description |
PRINTS | PR00615 | 8.7E-14 | 91 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MAENSCAGGS IDEGGSRAEQ DQQLLLPIAN VGRIMKQRLP HNAKISKEAK ETMQECASEF 60 IGFVTGEASD KCRRERRKTV NGDDICWALG TLGFDDYVGP LKRYLHIFRE QEGDQRSVLN 120 NNNNEDSVME EDHLHAPLHS PSSSPGQPST NPVARREAPP PFPAPPHFFN STSYGGDSQG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-37 | 20 | 110 | 3 | 93 | NF-YB |
4awl_B | 2e-37 | 20 | 110 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-37 | 20 | 110 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019174333.1 | 1e-95 | PREDICTED: transcriptional activator hap3-like | ||||
Swissprot | O82248 | 8e-48 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2K1ZLA2 | 3e-58 | A0A2K1ZLA2_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0008s22520.1 | 9e-59 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 3e-50 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|