![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc000389.1_g00005.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 88aa MW: 9470.67 Da PI: 8.776 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 98.2 | 6.3e-31 | 28 | 82 | 3 | 58 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 vrY eC++N Aa++Ggh++DGC Efmps g egt+aal+CaACgCHR+FHR+ v+ Itr_sc000389.1_g00005.1 28 IVRYGECQRNYAATTGGHVLDGCLEFMPS-GGEGTPAALTCAACGCHRSFHRQVVV 82 589*************************9.8899******************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 2.0E-16 | 29 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.8E-29 | 29 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.4E-25 | 30 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 24.167 | 31 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MKRSIRVDDR LDSTRRYTAG TTSRVTTIVR YGECQRNYAA TTGGHVLDGC LEFMPSGGEG 60 TPAALTCAAC GCHRSFHRQV VVSVATST |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
UniProt | Putative transcription factor. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020224980.1 | 7e-25 | mini zinc finger protein 3 | ||||
Swissprot | Q0J5F8 | 9e-22 | MIF4_ORYSJ; Mini zinc finger protein 4 | ||||
Swissprot | Q9SVL0 | 1e-21 | ZHD7_ARATH; Zinc-finger homeodomain protein 7 | ||||
TrEMBL | A0A2R6P9H7 | 8e-24 | A0A2R6P9H7_ACTCH; Mini zinc finger protein | ||||
STRING | Gorai.006G017300.1 | 8e-24 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1105 | 24 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50890.1 | 6e-24 | homeobox protein 28 |
Publications ? help Back to Top | |||
---|---|---|---|
|