PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

NF-YB

Protein Properties

Length: 128aa MW: 13953.5 Da PI: 4.9789

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc000246.1_g00026.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YC	24.3	6.8e-08	18	93	9	83
NF-YC 9 qiekatdfknhelPlarikkilkad.edvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaav 83 q e+++ ++lP+a + +i+k+ +d i+aea l+ fi +t + + + kr+tl d+ +++ Itr_sc000246.1_g00026.1 18 QSENHNPEYVRSLPIANVVRIMKKAlPDDANITAEAKLLVEECATEFISFITSEASERGQIEKRKTLTGDDVLNSL 93 556666666789********85449**********99999********************99998765 PP
2	NF-YB	127.4	5.2e-40	28	116	6	94
NF-YB 6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 r lPianv+rimkk+lP +a i+ +ak +v+ec++efisf+tseas++ q ekrkt++gdd+l +l tlGf +yvepl++yl+ky+ Itr_sc000246.1_g00026.1 28 RSLPIANVVRIMKKALPDDANITAEAKLLVEECATEFISFITSEASERGQIEKRKTLTGDDVLNSLNTLGFGNYVEPLRTYLMKYK 113 89************************************************************************************ PP NF-YB 92 ele 94 e + Itr_sc000246.1_g00026.1 114 END 116 965 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	6.6E-41	18	124	IPR009072	Histone-fold
SuperFamily	SSF47113	4.84E-32	28	125	IPR009072	Histone-fold
Pfam	PF00808	1.0E-21	29	90	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	2.4E-14	57	75	No hit	No description
PRINTS	PR00615	2.4E-14	76	94	No hit	No description
PRINTS	PR00615	2.4E-14	95	113	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 128 aa Download sequence Send to blast
MEGAPGGGGG GGSHQSSQSE NHNPEYVRSL PIANVVRIMK KALPDDANIT AEAKLLVEEC 60 ATEFISFITS EASERGQIEK RKTLTGDDVL NSLNTLGFGN YVEPLRTYLM KYKENDFKEE 120 NKGSNSRG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	4e-34	28	114	6	92	Transcription factor HapC (Eurofung)
4g92_B	4e-34	28	114	6	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019198523.1	8e-55	PREDICTED: nuclear transcription factor Y subunit B-8-like
Swissprot	Q8VYK4	3e-36	NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBL	A0A4D6MXJ7	2e-37	A0A4D6MXJ7_VIGUN; Nuclear transcription factor Y
STRING	Bo3g031490.1	1e-37	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G38880.7	2e-37	nuclear factor Y, subunit B1

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]