PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Han007635 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 188aa MW: 21067.6 Da PI: 4.7944 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 27.6 | 6.9e-09 | 10 | 57 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqk 46 W+ e d + +a ++ + +W++Ia++++ +++ +++k+++ Han007635 10 VWSREQDIAFENALVSYPDEddeeRWEKIAAEVPGNKSVEEIKNHYEL 57 6*****************99**************************75 PP | |||||||
2 | Myb_DNA-binding | 41.4 | 3.4e-13 | 123 | 166 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +WT+eE+ l++ + +++G+g+W++I+r + +Rt+ q+ + q+ Han007635 123 AWTEEEHRLFLLGLEKYGKGDWRSISRNFVVTRTPTQVAXHAQN 166 6****************************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.4E-4 | 3 | 59 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 7.039 | 3 | 59 | IPR017877 | Myb-like domain |
SMART | SM00717 | 9.3E-8 | 7 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.52E-8 | 9 | 67 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 7.7E-7 | 10 | 56 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.16E-6 | 11 | 59 | No hit | No description |
PROSITE profile | PS51294 | 16.064 | 116 | 172 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.21E-12 | 118 | 167 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.1E-9 | 120 | 170 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 5.3E-13 | 121 | 166 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 2.8E-11 | 123 | 166 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-11 | 123 | 165 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.37E-10 | 123 | 167 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MSDKKVKESV WSREQDIAFE NALVSYPDED DEERWEKIAA EVPGNKSVEE IKNHYELLLE 60 DLERIESGVV PLPVYSSSLD DSESQAGDVG TSKKGGNAGQ NINESNHGGK GSKSEQERRR 120 GIAWTEEEHR LFLLGLEKYG KGDWRSISRN FVVTRTPTQV AXHAQNISSF NSMNKIDGGQ 180 HHDITVSX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 1e-13 | 11 | 78 | 11 | 76 | RADIALIS |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young seedlings, developing leaves, sepals and trichomes. {ECO:0000269|PubMed:26243618}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021986305.1 | 1e-118 | transcription factor SRM1-like | ||||
Swissprot | Q9FNN6 | 3e-71 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A251VS29 | 1e-116 | A0A251VS29_HELAN; Putative duplicated homeodomain-like superfamily protein | ||||
STRING | XP_009351753.1 | 3e-77 | (Pyrus x bretschneideri) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08520.1 | 1e-73 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|