![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Han003945 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
|
||||||||||||
Family | GRAS | ||||||||||||
Protein Properties | Length: 107aa MW: 12644.5 Da PI: 9.6106 | ||||||||||||
Description | GRAS family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 87.9 | 1.6e-27 | 2 | 105 | 271 | 374 |
GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370 ++a++ re+ er+ +E+ + gre++nv+aceg er+er et+++W+ r +aGF+++pl+ ++ k ak ++ ++ + + ++e+ ++l++gWk+r ++++ Han003945 2 IDANATRETPERTLIEKNFWGREAMNVIACEGGERIERPETYKQWQVRNLRAGFRQLPLNRDILKLAKERVKSCYHKDFGIDEDGHWLLQGWKGRIIYAL 101 6899999********************************************************************889********************** PP GRAS 371 SaWr 374 S+W+ Han003945 102 SSWK 105 ***8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 16.175 | 1 | 85 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 5.7E-25 | 2 | 105 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 107 aa Download sequence Send to blast |
MIDANATRET PERTLIEKNF WGREAMNVIA CEGGERIERP ETYKQWQVRN LRAGFRQLPL 60 NRDILKLAKE RVKSCYHKDF GIDEDGHWLL QGWKGRIIYA LSSWKPV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022018328.1 | 9e-76 | scarecrow-like protein 30 | ||||
Refseq | XP_022018329.1 | 9e-76 | scarecrow-like protein 30 | ||||
Swissprot | P0C883 | 6e-42 | SCL33_ARATH; Scarecrow-like protein 33 | ||||
TrEMBL | A0A251S038 | 3e-74 | A0A251S038_HELAN; Putative transcription factor GRAS | ||||
STRING | XP_006486464.1 | 1e-53 | (Citrus sinensis) | ||||
STRING | XP_006435553.1 | 1e-53 | (Citrus clementina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G29060.1 | 2e-44 | GRAS family protein |