![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G040792.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 177aa MW: 20023.6 Da PI: 4.9818 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 48.2 | 2.3e-15 | 34 | 92 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+ +NRe+ArrsR RK++ ++eL v L++eN++ + l++ ++++ +l++e+ HL.SW.v1.0.G040792.1 34 RKRKRMLSNRESARRSRMRKQQHMDELVSQVGDLKKENSQIITSLNMTNQLYLNLEAEN 92 67899**************************************************9988 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 4.4E-18 | 30 | 94 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.691 | 32 | 95 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 2.7E-12 | 34 | 80 | No hit | No description |
SuperFamily | SSF57959 | 3.81E-13 | 34 | 88 | No hit | No description |
Pfam | PF00170 | 1.4E-11 | 34 | 92 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 2.56E-19 | 35 | 85 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 37 | 52 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MAGSSSTTTG ASSGYLDQET GQEEQVKVVA VDQRKRKRML SNRESARRSR MRKQQHMDEL 60 VSQVGDLKKE NSQIITSLNM TNQLYLNLEA ENSVLRAQMA ELTHRLQSLN EIIDCINSST 120 ISTTASTATY PFDDHDHLMF DDQDSQMMMM MMINPWNSIP LNQPIMAASA DQMYMY* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 46 | 53 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to specific DNA sequences in target gene promoters. BZIP2-BZIP63-KIN10 complex binds to the ETFQO promoter to up-regulate its transcription (PubMed:29348240). {ECO:0000250|UniProtKB:O65683, ECO:0000269|PubMed:29348240}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00267 | DAP | Transfer from AT2G18160 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010109918.1 | 1e-52 | bZIP transcription factor 11 | ||||
Swissprot | Q9SI15 | 6e-42 | BZIP2_ARATH; bZIP transcription factor 2 | ||||
TrEMBL | A0A2P5FP84 | 5e-69 | A0A2P5FP84_TREOI; Basic-leucine zipper transcription factor | ||||
STRING | XP_010109918.1 | 6e-52 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF613 | 34 | 147 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G18160.1 | 3e-38 | basic leucine-zipper 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|