![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G040640.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 98aa MW: 11239.9 Da PI: 10.1915 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.8 | 2.2e-17 | 23 | 70 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+ eEd ll ++v ++G g W +++++ g++R++k+c++rw++yl HL.SW.v1.0.G040640.1 23 KGAWSREEDNLLRECVDKYGEGKWYLVPSRAGLNRCRKSCRLRWLNYL 70 79*********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 23.76 | 18 | 74 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.5E-22 | 21 | 73 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.8E-14 | 22 | 72 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.7E-17 | 23 | 70 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.02E-21 | 24 | 97 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.25E-10 | 25 | 70 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.9E-6 | 74 | 97 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MVTVVVRDQR EGDSSGSGCA LRKGAWSREE DNLLRECVDK YGEGKWYLVP SRAGLNRCRK 60 SCRLRWLNYL KPGTKRGTFT ADEVDLVLRL HKLLGNRQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-14 | 21 | 97 | 5 | 80 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019182609.1 | 1e-40 | PREDICTED: transcription factor MYB75-like | ||||
Swissprot | Q9FNV9 | 3e-38 | MY113_ARATH; Transcription factor MYB113 | ||||
TrEMBL | A0A2P5ANF2 | 4e-42 | A0A2P5ANF2_PARAD; Octamer-binding transcription factor | ||||
STRING | Cagra.0463s0005.1.p | 8e-41 | (Capsella grandiflora) | ||||
STRING | VIT_14s0006g01280.t01 | 2e-40 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G66370.1 | 1e-40 | myb domain protein 113 |
Publications ? help Back to Top | |||
---|---|---|---|
|