![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G038436.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 87aa MW: 10060.6 Da PI: 8.658 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.2 | 1.2e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT Ed++l ++++ +G g W+ +++ g+ R++k+c++rw++yl HL.SW.v1.0.G038436.1 14 KGAWTVLEDQILTEYINTHGEGKWRNLPKEAGLQRCGKSCRLRWLNYL 61 79*********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 6.7E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.192 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 8.9E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.6E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 9.43E-22 | 15 | 87 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.09E-9 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 8.1E-8 | 65 | 87 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 7.818 | 66 | 87 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MGRSPCCPKE GLNKGAWTVL EDQILTEYIN THGEGKWRNL PKEAGLQRCG KSCRLRWLNY 60 LRPDIKRGNI SEEEEDLIIR LHKLLGN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-15 | 12 | 87 | 25 | 99 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18541146, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008393595.1 | 1e-51 | transcription repressor MYB5-like | ||||
Swissprot | Q9S9K9 | 1e-42 | MYB3_ARATH; Transcription factor MYB3 | ||||
TrEMBL | A0A2P5B1D3 | 4e-52 | A0A2P5B1D3_TREOI; MYB transcription factor | ||||
TrEMBL | A0A2P5DVN6 | 4e-52 | A0A2P5DVN6_PARAD; MYB transcription factor | ||||
STRING | XP_008393595.1 | 4e-51 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22640.1 | 5e-45 | myb domain protein 3 |