PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

HL.SW.v1.0.G038436.1

Organism

Humulus lupulus

Taxonomic ID

3486

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus

Family

MYB_related

Protein Properties

Length: 87aa MW: 10060.6 Da PI: 8.658

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
HL.SW.v1.0.G038436.1	genome	HOPBASE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.2	1.2e-15	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT Ed++l ++++ +G g W+ +++ g+ R++k+c++rw++yl HL.SW.v1.0.G038436.1 14 KGAWTVLEDQILTEYINTHGEGKWRNLPKEAGLQRCGKSCRLRWLNYL 61 79*********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	6.7E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.192	9	65	IPR017930	Myb domain
SMART	SM00717	8.9E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.6E-14	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	9.43E-22	15	87	IPR009057	Homeodomain-like
CDD	cd00167	5.09E-9	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	8.1E-8	65	87	IPR009057	Homeodomain-like
PROSITE profile	PS51294	7.818	66	87	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
MGRSPCCPKE GLNKGAWTVL EDQILTEYIN THGEGKWRNL PKEAGLQRCG KSCRLRWLNY 60 LRPDIKRGNI SEEEEDLIIR LHKLLGN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	4e-15	12	87	25	99	MYB TRANSFORMING PROTEIN
Search in ModeBase

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008393595.1	1e-51	transcription repressor MYB5-like
Swissprot	Q9S9K9	1e-42	MYB3_ARATH; Transcription factor MYB3
TrEMBL	A0A2P5B1D3	4e-52	A0A2P5B1D3_TREOI; MYB transcription factor
TrEMBL	A0A2P5DVN6	4e-52	A0A2P5DVN6_PARAD; MYB transcription factor
STRING	XP_008393595.1	4e-51	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	5e-45	myb domain protein 3

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]