PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus

Family

NAC

Protein Properties

Length: 104aa MW: 11895.6 Da PI: 6.7955

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
HL.SW.v1.0.G035931.1	genome	HOPBASE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	59.6	1e-18	3	54	1	53
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka 53 lp GfrFhPtdeel+++yL +kv ++++++ ++i evd++k+ePwdLp ++k HL.SW.v1.0.G035931.1 3 LPLGFRFHPTDEELITHYLSPKVLNNRFSA-KAIGEVDLNKCEPWDLPWRAKM 54 699************************9.89************954433 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.09E-20	2	74	IPR003441	NAC domain
PROSITE profile	PS51005	18.12	3	103	IPR003441	NAC domain
Pfam	PF02365	8.9E-9	4	67	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 104 aa Download sequence Send to blast
MELPLGFRFH PTDEELITHY LSPKVLNNRF SAKAIGEVDL NKCEPWDLPW RAKMGKTLVG 60 MKKTLDWSLS RGPRLHPWRR PELVARQGSG GDEVEADPWD WGE*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	7e-14	1	55	13	67	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269\|PubMed:15295076, ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:21303842, ECO:0000269\|PubMed:23340744, ECO:0000269\|PubMed:23459204, ECO:0000269\|PubMed:9351240}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19608714, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:20404534, ECO:0000269\|PubMed:21511905, ECO:0000269\|PubMed:22930749}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010088131.1	2e-31	NAC domain-containing protein 100
Swissprot	Q9FKA0	1e-25	NAC92_ARATH; NAC domain-containing protein 92
TrEMBL	A0A2P5CWF8	4e-30	A0A2P5CWF8_PARAD; NAC domain containing protein
STRING	XP_010088131.1	8e-31	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF17584	5	7

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G39610.1	5e-28	NAC domain containing protein 6

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Manacorda CA, et al. Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes. Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98 [PMID:23945002] Khan M,Rozhon W,Poppenberger B The role of hormones in the aging of plants - a mini-review. Gerontology, 2014. 60(1): p. 49-55 [PMID:24135638] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Bohner A,Kojima S,Hajirezaei M,Melzer M,von Wirén N Urea retranslocation from senescing Arabidopsis leaves is promoted by DUR3-mediated urea retrieval from leaf apoplast. Plant J., 2015. 81(3): p. 377-87 [PMID:25440717] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Kim H, et al. Circadian control of ORE1 by PRR9 positively regulates leaf senescence in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(33): p. 8448-8453 [PMID:30065116]