![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G032236.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 89aa MW: 10127.6 Da PI: 10.2206 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 66.2 | 6.1e-21 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+lvd+++++G g+W++ ++ g++R++k+c++rw +yl HL.SW.v1.0.G032236.1 14 KGPWTPEEDEKLVDYIRRHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.0E-26 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.191 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 9.7E-16 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.0E-19 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.91E-25 | 15 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.84E-12 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.5E-8 | 65 | 88 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 7.914 | 66 | 88 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MGRSPSSDEN GLKKGPWTPE EDEKLVDYIR RHGHGSWRAL PKLAGLNRCG KSCRLRWTNY 60 LRPDIKRGKF SEDEEKLIIN LHAVLGNK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-18 | 12 | 88 | 5 | 80 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250|UniProtKB:Q9M2D9}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by gravity in roots. {ECO:0000269|PubMed:24902892}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010087464.2 | 1e-57 | transcription factor MYB41 | ||||
Swissprot | Q9SBF3 | 7e-52 | MYB92_ARATH; Transcription factor MYB92 | ||||
TrEMBL | A0A2P5BL54 | 3e-56 | A0A2P5BL54_TREOI; MYB transcription factor | ||||
TrEMBL | W9QDG2 | 3e-56 | W9QDG2_9ROSA; Transcription factor | ||||
STRING | XP_010087464.1 | 5e-57 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G10280.1 | 3e-54 | myb domain protein 92 |
Publications ? help Back to Top | |||
---|---|---|---|
|