![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G025096.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 136aa MW: 15734.8 Da PI: 9.3382 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 46.6 | 7.4e-15 | 51 | 102 | 5 | 56 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 ++ rr+++NRe+ArrsR RKk +e L+e v L+ eN++Lk++l ++ +++ HL.SW.v1.0.G025096.1 51 QKLRRMISNRESARRSRWRKKRHLEDLTEQVNRLKVENRDLKNRLAHMAQQC 102 678***************************************9999999888 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.2E-13 | 47 | 111 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 6.8E-12 | 49 | 103 | No hit | No description |
PROSITE profile | PS50217 | 10.898 | 49 | 101 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.3E-11 | 51 | 102 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 6.07E-16 | 52 | 103 | No hit | No description |
SuperFamily | SSF57959 | 7.88E-12 | 52 | 102 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 54 | 69 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MFLSKEAAQC QYGPVFEVGE IEELWSLLQP GTINNSGSEG SNRAVYSVDE QKLRRMISNR 60 ESARRSRWRK KRHLEDLTEQ VNRLKVENRD LKNRLAHMAQ QCHVAWREND RLTSEFSALQ 120 SKLSDLCRIL VAMQS* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010999906.1 | 4e-53 | PREDICTED: basic leucine zipper 43 | ||||
TrEMBL | A0A2P5CWW1 | 2e-70 | A0A2P5CWW1_PARAD; Basic-leucine zipper transcription factor | ||||
STRING | POPTR_0014s01390.1 | 2e-51 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5996 | 30 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49760.1 | 4e-22 | basic leucine-zipper 5 |