PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus

Family

NAC

Protein Properties

Length: 69aa MW: 7642.63 Da PI: 3.8804

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
HL.SW.v1.0.G021104.1	genome	HOPBASE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	53.1	1.1e-16	21	67	1	48
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 lppGfrFhPtdeel+++yL+ kv + ++ i+evd++++ePw+Lp HL.SW.v1.0.G021104.1 21 LPPGFRFHPTDEELITFYLASKVFNGTFCG-VDIAEVDLNRCEPWELP 67 79***********************877.34************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.75E-18	15	68	IPR003441	NAC domain
PROSITE profile	PS51005	19.795	21	68	IPR003441	NAC domain
Pfam	PF02365	5.2E-8	22	64	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 69 aa Download sequence Send to blast
MLAMEEVLRE LNGEGINDQG LPPGFRFHPT DEELITFYLA SKVFNGTFCG VDIAEVDLNR 60 CEPWELPG*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269\|PubMed:12837947, ECO:0000269\|PubMed:17122068}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269\|PubMed:16854978}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024020105.1	4e-39	protein CUP-SHAPED COTYLEDON 3
Swissprot	Q9S851	2e-30	NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBL	A0A2P5A974	7e-38	A0A2P5A974_PARAD; NAC domain containing protein
TrEMBL	A0A2P5EY97	8e-38	A0A2P5EY97_TREOI; NAC domain containing protein
TrEMBL	W9QWF7	1e-37	W9QWF7_9ROSA; Protein CUP-SHAPED COTYLEDON 3
STRING	XP_010094524.1	2e-38	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF17584	5	7

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G76420.1	7e-33	NAC family protein

Publications ? help Back to Top
Chen C, et al. Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.). J. Exp. Bot., 2014. 65(17): p. 4943-58 [PMID:24962999] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Espinosa-Ruiz A, et al. TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549]