PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G018519.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 87aa MW: 10065.7 Da PI: 9.4695 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.1 | 9.5e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+ l++ v+++G g+W++ ++ g+ R++k+c++rw +yl HL.SW.v1.0.G018519.1 14 KGPWTPEEDQVLINFVQKFGHGNWRALPKQAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.6E-27 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.347 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 3.1E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.3E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.26E-25 | 15 | 87 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.18E-12 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.9E-10 | 65 | 87 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 8.224 | 66 | 87 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MGRAPCCEKM GLKKGPWTPE EDQVLINFVQ KFGHGNWRAL PKQAGLLRCG KSCRLRWINY 60 LRPDIKRGNF TPEEEETIIN LHQMLGN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-17 | 12 | 87 | 5 | 79 | B-MYB |
1gv2_A | 2e-17 | 12 | 87 | 2 | 76 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 3e-17 | 12 | 87 | 25 | 99 | MYB TRANSFORMING PROTEIN |
1mse_C | 2e-17 | 12 | 87 | 2 | 76 | C-Myb DNA-Binding Domain |
1msf_C | 2e-17 | 12 | 87 | 2 | 76 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269|PubMed:24415840}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:24415840}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024026796.1 | 2e-57 | transcription factor MYB4 | ||||
Swissprot | Q9SJX8 | 4e-54 | MYB14_ARATH; Transcription factor MYB14 | ||||
TrEMBL | A0A2P5FLN0 | 3e-55 | A0A2P5FLN0_TREOI; MYB transcription factor | ||||
STRING | XP_006479545.1 | 2e-55 | (Citrus sinensis) | ||||
STRING | XP_006443843.1 | 2e-55 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 2e-56 | myb domain protein 14 |
Publications ? help Back to Top | |||
---|---|---|---|
|