![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | HL.SW.v1.0.G007962.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 111aa MW: 12421.3 Da PI: 7.8642 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 116.4 | 1.8e-36 | 7 | 106 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 +C +Ck+lrrkC+++C++apyf eqp+kfanvhk+F asn kll++l +++reda++sl+ye ++++rd vyG+vgvi+ lq+ql+q HL.SW.v1.0.G007962.1 7 PCTGCKLLRRKCQPECMFAPYFLPEQPQKFANVHKVFEASNAAKLLNELAPSHREDAVNSLAYEVDMQLRDLVYGCVGVITLLQHQLRQ 95 7**************************************************************************************** PP DUF260 90 lkaelallkee 100 l+ +l+++k+e HL.SW.v1.0.G007962.1 96 LQMDLSSTKSE 106 ******99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 22.328 | 6 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.0E-36 | 7 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MASSNSPCTG CKLLRRKCQP ECMFAPYFLP EQPQKFANVH KVFEASNAAK LLNELAPSHR 60 EDAVNSLAYE VDMQLRDLVY GCVGVITLLQ HQLRQLQMDL SSTKSELSKY * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 9e-47 | 3 | 110 | 7 | 114 | LOB family transfactor Ramosa2.1 |
5ly0_B | 9e-47 | 3 | 110 | 7 | 114 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_026423718.1 | 5e-61 | protein ASYMMETRIC LEAVES 2-like | ||||
Refseq | XP_026423724.1 | 5e-61 | protein ASYMMETRIC LEAVES 2-like | ||||
Swissprot | Q32SG3 | 7e-54 | LBD6_MAIZE; LOB domain-containing protein 6 | ||||
TrEMBL | A0A200PM64 | 2e-59 | A0A200PM64_9MAGN; Uncharacterized protein | ||||
TrEMBL | A0A443NSI2 | 2e-59 | A0A443NSI2_9MAGN; LOB domain-containing protein 6-like protein | ||||
STRING | VIT_00s0340g00090.t01 | 1e-59 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF9625 | 30 | 43 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65620.4 | 3e-55 | LBD family protein |