PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus

Family

bZIP

Protein Properties

Length: 97aa MW: 11126.9 Da PI: 10.4641

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
HL.SW.v1.0.G005970.1	genome	HOPBASE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	41.5	2.9e-13	21	68	5	52
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 kr++r NR +A rs +RK +i+eLe+kv++L++e ++L +l HL.SW.v1.0.G005970.1 21 KRAKRILANRQSAARSKERKARYIQELERKVQTLQTEATTLSAQLTLF 68 9****************************************9888665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	5.1E-13	17	81	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	9.875	19	69	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.4E-11	21	67	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.63E-12	21	76	No hit	No description
Gene3D	G3DSA:1.20.5.170	2.8E-12	21	77	No hit	No description
CDD	cd14703	1.59E-19	22	69	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 97 aa Download sequence Send to blast
MDAKKAMPPD KLAELWTIDP KRAKRILANR QSAARSKERK ARYIQELERK VQTLQTEATT 60 LSAQLTLFQG ILTTLSQSNG KYMYDYATIS FLAEVFK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269\|PubMed:27896439}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004500364.1	2e-41	transcription factor RF2b-like
Refseq	XP_010108472.1	3e-41	transcription factor RF2b
Swissprot	O22873	9e-37	BZP18_ARATH; bZIP transcription factor 18
TrEMBL	A0A0B2NXV8	7e-41	A0A0B2NXV8_GLYSO; Transcription factor RF2b
TrEMBL	A0A2Z6MQZ7	6e-41	A0A2Z6MQZ7_TRISU; Uncharacterized protein
STRING	XP_004500364.1	6e-41	(Cicer arietinum)
STRING	XP_010108472.1	1e-40	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5214	34	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G06850.2	6e-42	basic leucine-zipper 52

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Pawar V, et al. A novel family of plant nuclear envelope-associated proteins. J. Exp. Bot., 2016. 67(19): p. 5699-5710 [PMID:27630107] Gibalová A, et al. Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte. Plant Reprod, 2017. 30(1): p. 1-17 [PMID:27896439] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S Efficient gene tagging in Arabidopsis thaliana using a gene trap approach. Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7 [PMID:9356517]