PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MIKC_MADS

Protein Properties

Length: 268aa MW: 30849.1 Da PI: 9.8716

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.N017200.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.1	1.8e-31	45	94	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ Gorai.N017200.1 45 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 94 79***********************************************8 PP
2	K-box	114.4	1.1e-37	112	208	4	100
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 s++ s++e +a+ +qqe++kL+++i+nLq+ +Rh+lGe+++ L +keL++Le++Lek++++iRskKnell+++ie++qk+e +l+++n+ Lr+k Gorai.N017200.1 112 SNTGSVAEVNAQFYQQEADKLRNQIRNLQNANRHMLGESIGGLPMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAK 205 3344499*************************************************************************************** PP K-box 98 lee 100 ++e Gorai.N017200.1 206 IAE 208 986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	34.132	37	97	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.1E-42	37	96	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.71E-34	38	126	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.65E-46	38	112	No hit	No description
PRINTS	PR00404	5.4E-33	39	59	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	39	93	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.0E-26	46	93	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.4E-33	59	74	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.4E-33	74	95	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	1.1E-27	121	206	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	14.999	122	212	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0048366	Biological Process	leaf development
GO:0048440	Biological Process	carpel development
GO:0048443	Biological Process	stamen development
GO:0048497	Biological Process	maintenance of floral organ identity
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 268 aa Download sequence Send to blast
MILLPSSWFF FWFFGLFQLG SMVYPNESLE NSPQKKMGRG KIEIKRIENT TNRQVTFCKR 60 RNGLLKKAYE LSVLCDAEVA LIVFSSRGRL YEYANNSVKA TIERYKKASD SSNTGSVAEV 120 NAQFYQQEAD KLRNQIRNLQ NANRHMLGES IGGLPMKELK SLESRLEKGI SRIRSKKNEL 180 LFAEIEYMQK REIDLHNNNQ LLRAKIAENE RKQQSMNLMP GGSSANFEAL HSQPYDSRNY 240 FQVDALQPAT NYYNPQQQQD QIALQLV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	4e-21	37	110	1	74	Myocyte-specific enhancer factor 2B
1tqe_Q	4e-21	37	110	1	74	Myocyte-specific enhancer factor 2B
1tqe_R	4e-21	37	110	1	74	Myocyte-specific enhancer factor 2B
1tqe_S	4e-21	37	110	1	74	Myocyte-specific enhancer factor 2B
6c9l_A	4e-21	37	110	1	74	Myocyte-specific enhancer factor 2B
6c9l_B	4e-21	37	110	1	74	Myocyte-specific enhancer factor 2B
6c9l_C	4e-21	37	110	1	74	Myocyte-specific enhancer factor 2B
6c9l_D	4e-21	37	110	1	74	Myocyte-specific enhancer factor 2B
6c9l_E	4e-21	37	110	1	74	Myocyte-specific enhancer factor 2B
6c9l_F	4e-21	37	110	1	74	Myocyte-specific enhancer factor 2B
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Gra.1551	0.0	flower\| flowering

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Detected early in the floral meristem but mostly expressed in stamen and carpel primordia. {ECO:0000269\|PubMed:1675158}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms a heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development. Controls AHL21/GIK, a multifunctional chromatin modifier in reproductive organ patterning and differentiation (PubMed:19956801). Induces microsporogenesis through the activation of SPL/NZZ (PubMed:15254538). {ECO:0000269\|PubMed:15254538, ECO:0000269\|PubMed:19956801}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00609	ChIP-seq	Transfer from AT4G18960	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by the A class floral homeotic protein APETALA2 and by other repressors like LEUNIG, SEUSS, SAP or CURLY LEAF. Positively regulated by both LEAFY and APETALA1. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. Up-regulated by HUA2. {ECO:0000269\|PubMed:10198637, ECO:0000269\|PubMed:11058164, ECO:0000269\|PubMed:1675158, ECO:0000269\|PubMed:17794879, ECO:0000269\|PubMed:18281509, ECO:0000269\|PubMed:19783648, ECO:0000269\|PubMed:9783581}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY083173	0.0	AY083173.1 Gossypium hirsutum AG-like protein (MADS-3) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012466273.1	0.0	PREDICTED: floral homeotic protein AGAMOUS-like isoform X1
Refseq	XP_012466274.1	0.0	PREDICTED: floral homeotic protein AGAMOUS-like isoform X2
Swissprot	P17839	1e-125	AG_ARATH; Floral homeotic protein AGAMOUS
TrEMBL	A0A0D2VK16	0.0	A0A0D2VK16_GOSRA; Uncharacterized protein
STRING	Gorai.N017200.1	0.0	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6181	22	37

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	1e-125	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Gorai.N017200.1
Entrez Gene	105784902

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Huang Z, et al. APETALA2 antagonizes the transcriptional activity of AGAMOUS in regulating floral stem cells in Arabidopsis thaliana. New Phytol., 2017. 215(3): p. 1197-1209 [PMID:27604611] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Uemura A, et al. Regulation of floral meristem activity through the interaction of AGAMOUS, SUPERMAN, and CLAVATA3 in Arabidopsis. Plant Reprod, 2018. 31(1): p. 89-105 [PMID:29218596]