![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.013G191800.1 | ||||||||
Common Name | B456_013G191800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 167aa MW: 19071.8 Da PI: 10.3068 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 169.7 | 9.3e-53 | 8 | 142 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lppGfrFhPtdeel+ +yL kk++++++++ ++i++vdiyk++PwdLp k+ +ekewyfFs+rd+ky++g r+nra+ sgyWkatg+dk Gorai.013G191800.1 8 LPPGFRFHPTDEELILHYLMKKLSSSPFPV-SIIADVDIYKFDPWDLPDKAVFGEKEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKI 97 79****************************.89***************7777899************************************ PP NAM 92 vlsk..kgel........vglkktLvfykgrapkgektdWvmheyrl 128 ++++ + +g+kk Lvfykgr pkg kt+W+mheyrl Gorai.013G191800.1 98 IVASsmA--AgrggvfsnIGVKKALVFYKGRPPKGIKTNWIMHEYRL 142 **97550..355566778***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.02E-60 | 4 | 149 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.822 | 8 | 167 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.1E-27 | 9 | 142 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MRLPHSSLPP GFRFHPTDEE LILHYLMKKL SSSPFPVSII ADVDIYKFDP WDLPDKAVFG 60 EKEWYFFSPR DRKYPNGARP NRAAGSGYWK ATGTDKIIVA SSMAAGRGGV FSNIGVKKAL 120 VFYKGRPPKG IKTNWIMHEY RLSQNPNPNS NNRSFKSKDC SMRLDDW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-67 | 3 | 167 | 12 | 157 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-67 | 3 | 167 | 12 | 157 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-67 | 3 | 167 | 12 | 157 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-67 | 3 | 167 | 12 | 157 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
3swm_B | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
3swm_C | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
3swm_D | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
3swp_A | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
3swp_B | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
3swp_C | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
3swp_D | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
4dul_A | 3e-67 | 3 | 167 | 12 | 157 | NAC domain-containing protein 19 |
4dul_B | 3e-67 | 3 | 167 | 12 | 157 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gra.1281 | 0.0 | flower| flowering |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 48811276 | 0.0 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012463494.1 | 1e-122 | PREDICTED: NAC domain-containing protein 18-like, partial | ||||
Swissprot | Q84TD6 | 1e-81 | NAC47_ARATH; NAC transcription factor 47 | ||||
TrEMBL | A0A2P5QWE5 | 1e-121 | A0A2P5QWE5_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.013G191800.1 | 1e-121 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM190 | 28 | 276 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G04070.1 | 6e-82 | NAC domain containing protein 47 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.013G191800.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|