![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.012G169300.1 | ||||||||
Common Name | B456_012G169300, LOC105779156 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 133aa MW: 14868.2 Da PI: 10.6497 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 120.9 | 1.1e-37 | 8 | 129 | 1 | 115 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lp GfrFhPtdeel+ +yL kk++++++++ ++i++vdiyk++PwdLp k+ +ekew fFs+rd+ky++g r+n at+sg+Wkatg k Gorai.012G169300.1 8 LPLGFRFHPTDEELILHYLMKKLTSSPFPV-SIIADVDIYKFDPWDLPDKAVLGEKEWNFFSPRDRKYPNGARPNGATSSGFWKATGIVKI 97 699***************************.89***************7777899***********************************9 PP NAM 92 vlsk..kgel........vglkktLvfykgrapk 115 ++++ + +g+kk Lvf++ ++p+ Gorai.012G169300.1 98 IVASsmA--AgrggvhfnIGVKKALVFHRRNKPS 129 9997550..345566778**********988876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.96E-42 | 5 | 129 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 39.203 | 8 | 132 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.2E-17 | 9 | 125 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MRHPHSSLPL GFRFHPTDEE LILHYLMKKL TSSPFPVSII ADVDIYKFDP WDLPDKAVLG 60 EKEWNFFSPR DRKYPNGARP NGATSSGFWK ATGIVKIIVA SSMAAGRGGV HFNIGVKKAL 120 VFHRRNKPST HL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-44 | 7 | 123 | 16 | 123 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-44 | 7 | 123 | 16 | 123 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-44 | 7 | 123 | 16 | 123 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-44 | 7 | 123 | 16 | 123 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-44 | 7 | 123 | 19 | 126 | NAC domain-containing protein 19 |
3swm_B | 4e-44 | 7 | 123 | 19 | 126 | NAC domain-containing protein 19 |
3swm_C | 4e-44 | 7 | 123 | 19 | 126 | NAC domain-containing protein 19 |
3swm_D | 4e-44 | 7 | 123 | 19 | 126 | NAC domain-containing protein 19 |
3swp_A | 4e-44 | 7 | 123 | 19 | 126 | NAC domain-containing protein 19 |
3swp_B | 4e-44 | 7 | 123 | 19 | 126 | NAC domain-containing protein 19 |
3swp_C | 4e-44 | 7 | 123 | 19 | 126 | NAC domain-containing protein 19 |
3swp_D | 4e-44 | 7 | 123 | 19 | 126 | NAC domain-containing protein 19 |
4dul_A | 4e-44 | 7 | 123 | 16 | 123 | NAC domain-containing protein 19 |
4dul_B | 4e-44 | 7 | 123 | 16 | 123 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gra.1281 | 1e-146 | flower| flowering |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 48811276 | 1e-146 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012458351.1 | 1e-93 | PREDICTED: NAC transcription factor NAM-B1-like | ||||
Swissprot | Q84TD6 | 5e-56 | NAC47_ARATH; NAC transcription factor 47 | ||||
TrEMBL | A0A0D2TQS1 | 3e-92 | A0A0D2TQS1_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.012G169300.1 | 4e-93 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM190 | 28 | 276 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G04070.2 | 2e-58 | NAC domain containing protein 47 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.012G169300.1 |
Entrez Gene | 105779156 |
Publications ? help Back to Top | |||
---|---|---|---|
|