![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.010G251100.1 | ||||||||
Common Name | B456_010G251100, LOC105773324 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 202aa MW: 23406.4 Da PI: 4.8057 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 88.8 | 9.6e-28 | 16 | 139 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv...ePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 ppG+rF+Ptd el+++yL kkv+g++l+ ++i+e++iy ePw++ +++++k y F+k +kk ++gk+ r++ g+Wk + + Gorai.010G251100.1 16 PPGYRFEPTDIELLQDYLLKKVNGEPLPY-NIISECEIYGNqgkEPWKIF--IETSTKTFYVFTKLKKK-SKGKNIDRVAGCGTWKGQRT- 101 9****************************.89******9754459****6..66677788888888776.689*************9876. PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ ++ ++g +k +vf + +++g+k +W+mhe++l Gorai.010G251100.1 102 DPIMY-EEMKIGNRKLFVFQVKGSNEGVKGHWIMHEFSL 139 67777.7899**********9999*************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.54E-32 | 5 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 30.921 | 15 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.0E-18 | 16 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MEFDTYDYEF LMTGIPPGYR FEPTDIELLQ DYLLKKVNGE PLPYNIISEC EIYGNQGKEP 60 WKIFIETSTK TFYVFTKLKK KSKGKNIDRV AGCGTWKGQR TDPIMYEEMK IGNRKLFVFQ 120 VKGSNEGVKG HWIMHEFSLV DEEDKQIGDY VLCSIRNKNA KDDTEEEEPP MKKMRYNSED 180 HNSPEPTSSD SPLQTLLSDW S* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 7e-22 | 15 | 160 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 7e-22 | 15 | 160 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 7e-22 | 15 | 160 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 7e-22 | 15 | 160 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 7e-22 | 15 | 160 | 20 | 170 | NAC domain-containing protein 19 |
3swm_B | 7e-22 | 15 | 160 | 20 | 170 | NAC domain-containing protein 19 |
3swm_C | 7e-22 | 15 | 160 | 20 | 170 | NAC domain-containing protein 19 |
3swm_D | 7e-22 | 15 | 160 | 20 | 170 | NAC domain-containing protein 19 |
3swp_A | 7e-22 | 15 | 160 | 20 | 170 | NAC domain-containing protein 19 |
3swp_B | 7e-22 | 15 | 160 | 20 | 170 | NAC domain-containing protein 19 |
3swp_C | 7e-22 | 15 | 160 | 20 | 170 | NAC domain-containing protein 19 |
3swp_D | 7e-22 | 15 | 160 | 20 | 170 | NAC domain-containing protein 19 |
4dul_A | 7e-22 | 15 | 160 | 17 | 167 | NAC domain-containing protein 19 |
4dul_B | 7e-22 | 15 | 160 | 17 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012450554.1 | 1e-149 | PREDICTED: NAC domain-containing protein 55-like | ||||
TrEMBL | A0A0D2UKM5 | 1e-147 | A0A0D2UKM5_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.010G251100.1 | 1e-148 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13343 | 7 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G10490.1 | 8e-26 | NAC domain containing protein 52 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.010G251100.1 |
Entrez Gene | 105773324 |
Publications ? help Back to Top | |||
---|---|---|---|
|