PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.010G081800.2 | ||||||||
Common Name | B456_010G081800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 204aa MW: 22291.5 Da PI: 10.5631 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 43.7 | 6.5e-14 | 113 | 157 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ +++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky Gorai.010G081800.2 113 PWTEEEHRIFLIGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 157 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.60.10 | 4.9E-4 | 3 | 20 | IPR001878 | Zinc finger, CCHC-type |
PROSITE profile | PS50158 | 8.532 | 3 | 18 | IPR001878 | Zinc finger, CCHC-type |
PROSITE profile | PS51294 | 19.74 | 105 | 162 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.97E-18 | 108 | 162 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.8E-18 | 109 | 161 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.1E-11 | 110 | 156 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.4E-10 | 110 | 160 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.21E-9 | 113 | 158 | No hit | No description |
Pfam | PF00249 | 3.1E-11 | 113 | 157 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MGRKCSHCGN IGHNSRTCTT FRSSAAGMGS GLRLFGFQLQ LDVSSPSVVS NLMMKKSFSM 60 DCLSSSPSPS PSPSPSSLSS SRVSIDENSD KTSMGYLSDG LMGRSPDRKK GVPWTEEEHR 120 IFLIGLEKLG KGDWRGISRN FVTTRTPTQV ASHAQKYFLR QATLNKKNRR SSLFDMVPSF 180 FNSMVLNETI CLRLISCSKT MAG* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gra.861 | 0.0 | seedling |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 48741149 | 0.0 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269|PubMed:12172034}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00565 | DAP | Transfer from AT5G56840 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GQ393239 | 1e-135 | GQ393239.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS0204 SSR marker CGR5100 genomic sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012452356.1 | 1e-112 | PREDICTED: transcription factor MYB1R1-like | ||||
Swissprot | Q7XC57 | 4e-48 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | A0A0D2V7A2 | 1e-147 | A0A0D2V7A2_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.010G081800.1 | 1e-111 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G56840.1 | 1e-60 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.010G081800.2 |
Publications ? help Back to Top | |||
---|---|---|---|
|