PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.010G032700.1

Common Name

B456_010G032700

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

M-type_MADS

Protein Properties

Length: 64aa MW: 7039.19 Da PI: 11.3251

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.010G032700.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	87.6	6.7e-28	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRrng+lKKA+EL +LCdaev v ifsstgkly+++s Gorai.010G032700.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVTIFSSTGKLYDFAS 59 8***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	4.3E-38	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	30.978	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.83E-27	2	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.96E-36	2	60	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-28	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.6E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-28	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 64 aa Download sequence Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVTIFSS TGKLYDFAST 60 RSF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	4e-19	1	60	1	60	MEF2C
5f28_B	4e-19	1	60	1	60	MEF2C
5f28_C	4e-19	1	60	1	60	MEF2C
5f28_D	4e-19	1	60	1	60	MEF2C
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed at high levels in leaves, moderate levels in roots, seedlings and stems, and at low levels in flowers, pollen and siliques. Accumulates in leaf guard cells and trichomes. Also present in epidermal cells of roots (PubMed:11115127, PubMed:12837945, PubMed:12949148). Expressed in mature guard cells (PubMed:17704216). {ECO:0000269\|PubMed:11115127, ECO:0000269\|PubMed:12837945, ECO:0000269\|PubMed:12949148, ECO:0000269\|PubMed:17704216}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269\|PubMed:17704216, ECO:0000269\|PubMed:24876250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269\|PubMed:18579782}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC155659	4e-97	KC155659.1 Gossypium hirsutum MADS box protein MADS64 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021283893.1	1e-35	MADS-box transcription factor 27-like
Swissprot	A2RVQ5	1e-30	AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBL	A0A0D2R1C7	5e-37	A0A0D2R1C7_GOSRA; Uncharacterized protein
STRING	Gorai.010G032700.1	9e-38	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G57230.1	5e-33	AGAMOUS-like 16

Link Out ? help Back to Top
Phytozome	Gorai.010G032700.1

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Yang K,Jiang M,Le J A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell. J Integr Plant Biol, 2014. 56(6): p. 539-49 [PMID:24386951]