|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Gorai.010G032700.1 |
Common Name | B456_010G032700 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
Family |
M-type_MADS |
Protein Properties |
Length: 64aa MW: 7039.19 Da PI: 11.3251 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Gorai.010G032700.1 | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 87.6 | 6.7e-28 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
ri+n++ rqvtfskRrng+lKKA+EL +LCdaev v ifsstgkly+++s
Gorai.010G032700.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVTIFSSTGKLYDFAS 59
8***********************************************86 PP
|
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | TISSUE SPECIFICITY: Expressed at high levels in leaves, moderate levels in roots, seedlings and stems, and at low levels in flowers, pollen and siliques. Accumulates in leaf guard cells and trichomes. Also present in epidermal cells of roots (PubMed:11115127, PubMed:12837945, PubMed:12949148). Expressed in mature guard cells (PubMed:17704216). {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:17704216}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | KC155659 | 4e-97 | KC155659.1 Gossypium hirsutum MADS box protein MADS64 mRNA, complete cds. |