PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

BES1

Protein Properties

Length: 314aa MW: 34008.1 Da PI: 9.0206

Description

BES1 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.009G204600.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF822	212.7	9.5e-66	15	149	4	142
DUF822 4 grkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspessl 94 +rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc eAGwvvedDGttyrkg+kp+ ++agssa+++p ss+ Gorai.009G204600.1 15 RRKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCVEAGWVVEDDGTTYRKGCKPP-PIDIAGSSAKITPYSSQ 104 79*********************************************************************.************* PP DUF822 95 qsslkssalaspvesysaspksssfpspssldsislasaasllpvlsv 142 + s+ ssa++sp++s + sp+sssfpsp+++d ++ +sllp+l+ Gorai.009G204600.1 105 NPSPLSSAFPSPIPSCQVSPSSSSFPSPTRTDANNP---SSLLPFLRS 149 ******************************9966...467777665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF05687	7.9E-62	15	137	IPR008540	BES1/BZR1 plant transcription factor, N-terminal

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009742	Biological Process	brassinosteroid mediated signaling pathway
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0048316	Biological Process	seed development
GO:0048481	Biological Process	plant ovule development
GO:0005634	Cellular Component	nucleus
GO:0005829	Cellular Component	cytosol
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 314 aa Download sequence Send to blast
MTSDGATSTP APVPRRKPSW RERENNRRRE RRRRAIAAKI YTGLRAQGNY NLPKHCDNNE 60 VLKALCVEAG WVVEDDGTTY RKGCKPPPID IAGSSAKITP YSSQNPSPLS SAFPSPIPSC 120 QVSPSSSSFP SPTRTDANNP SSLLPFLRSA IPSSLPPLRI SNSAPVTPPL SSPTSRNPKP 180 IPNWEAIAKE SMASFNYPFY AVSAPASPTH RHFHAPATIP ECDESDTSTV ESGQWISFQK 240 FAPSTSQVPT SPTFNLVKPL APQSLPTGFI GEQGRVSEFQ FESGQVKPWE GERIHEVGLD 300 DLELTLGSGK ARC*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5zd4_A	1e-34	15	97	371	453	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B	1e-34	15	97	371	453	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C	1e-34	15	97	371	453	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D	1e-34	15	97	371	453	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	14	33	RRKPSWRERENNRRRERRRR

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Accumulates in the growing region of the hypocotyl. {ECO:0000269\|PubMed:11970900}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that binds to the brassinosteroid (BR) response element (BRRE) 5'-CGTG(T/C)G-3' in gene promoter. Regulates positively the brassinosteroid-signaling pathway. Mediates downstream growth responses and negative feedback regulation of brassinosteroid biosynthesis. Promotes growth. Modulates ovule initiation and development by monitoring the expression of genes related to ovule development (e.g. HLL, ANT, and AP2). {ECO:0000269\|PubMed:15681342, ECO:0000269\|PubMed:22914576}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00237	DAP	Transfer from AT1G75080	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By brassinosteroid (BR). {ECO:0000269\|PubMed:15681342}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JX589267	2e-69	JX589267.1 Gossypium hirsutum clone NBRI_GE23932 microsatellite sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012444980.1	0.0	PREDICTED: protein BRASSINAZOLE-RESISTANT 1
Refseq	XP_012444981.1	0.0	PREDICTED: protein BRASSINAZOLE-RESISTANT 1
Swissprot	Q8S307	1e-146	BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBL	A0A0D2UQZ3	0.0	A0A0D2UQZ3_GOSRA; Uncharacterized protein
STRING	Gorai.009G204600.1	0.0	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2472	27	72

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G75080.2	1e-142	BES1 family protein

Link Out ? help Back to Top
Phytozome	Gorai.009G204600.1
Entrez Gene	105769105

Publications ? help Back to Top
Wang H, et al. Dual role of BKI1 and 14-3-3 s in brassinosteroid signaling to link receptor with transcription factors. Dev. Cell, 2011. 21(5): p. 825-34 [PMID:22075146] Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Liu L, et al. Ectopic expression of a BZR1-1D transcription factor in brassinosteroid signalling enhances carotenoid accumulation and fruit quality attributes in tomato. Plant Biotechnol. J., 2014. 12(1): p. 105-15 [PMID:24102834] Kim B, et al. Darkness and gulliver2/phyB mutation decrease the abundance of phosphorylated BZR1 to activate brassinosteroid signaling in Arabidopsis. Plant J., 2014. 77(5): p. 737-47 [PMID:24387668] He X, et al. A genotypic difference in primary root length is associated with the inhibitory role of transforming growth factor-beta receptor-interacting protein-1 on root meristem size in wheat. Plant J., 2014. 77(6): p. 931-43 [PMID:24467344] Oh E, et al. Cell elongation is regulated through a central circuit of interacting transcription factors in the Arabidopsis hypocotyl. Elife, 2015. [PMID:24867218] Zhang D,Jing Y,Jiang Z,Lin R The Chromatin-Remodeling Factor PICKLE Integrates Brassinosteroid and Gibberellin Signaling during Skotomorphogenic Growth in Arabidopsis. Plant Cell, 2014. 26(6): p. 2472-2485 [PMID:24920333] Shimada S, et al. Formation and dissociation of the BSS1 protein complex regulates plant development via brassinosteroid signaling. Plant Cell, 2015. 27(2): p. 375-90 [PMID:25663622] Chaiwanon J,Wang ZY Spatiotemporal brassinosteroid signaling and antagonism with auxin pattern stem cell dynamics in Arabidopsis roots. Curr. Biol., 2015. 25(8): p. 1031-42 [PMID:25866388] Zhang Y, et al. Brassinosteroid is required for sugar promotion of hypocotyl elongation in Arabidopsis in darkness. Planta, 2015. 242(4): p. 881-93 [PMID:25998528] Jiang J, et al. The Intrinsically Disordered Protein BKI1 Is Essential for Inhibiting BRI1 Signaling in Plants. Mol Plant, 2015. 8(11): p. 1675-8 [PMID:26296798] Zhang Y,He J Sugar-induced plant growth is dependent on brassinosteroids. Plant Signal Behav, 2015. 10(12): p. e1082700 [PMID:26340221] Anne P, et al. OCTOPUS Negatively Regulates BIN2 to Control Phloem Differentiation in Arabidopsis thaliana. Curr. Biol., 2015. 25(19): p. 2584-90 [PMID:26387715] Wang R, et al. The Brassinosteroid-Activated BRI1 Receptor Kinase Is Switched off by Dephosphorylation Mediated by Cytoplasm-Localized PP2A B' Subunits. Mol Plant, 2016. 9(1): p. 148-157 [PMID:26517938] Youn JH, et al. ARF7 increases the endogenous contents of castasterone through suppression of BAS1 expression in Arabidopsis thaliana. Phytochemistry, 2016. 122: p. 34-44 [PMID:26608667] Chaiwanon J,Garcia VJ,Cartwright H,Sun Y,Wang ZY Immunophilin-like FKBP42/TWISTED DWARF1 Interacts with the Receptor Kinase BRI1 to Regulate Brassinosteroid Signaling in Arabidopsis. Mol Plant, 2016. 9(4): p. 593-600 [PMID:26808213] Yang X,Bai Y,Shang J,Xin R,Tang W The antagonistic regulation of abscisic acid-inhibited root growth by brassinosteroids is partially mediated via direct suppression of ABSCISIC ACID INSENSITIVE 5 expression by BRASSINAZOLE RESISTANT 1. Plant Cell Environ., 2016. 39(9): p. 1994-2003 [PMID:27149247] Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling. Nat Plants, 2016. 2: p. 16013 [PMID:27249348] Zhang Z, et al. TOR Signaling Promotes Accumulation of BZR1 to Balance Growth with Carbon Availability in Arabidopsis. Curr. Biol., 2016. 26(14): p. 1854-60 [PMID:27345161] Zhang Y, et al. Functional characterization of GmBZL2 (AtBZR1 like gene) reveals the conserved BR signaling regulation in Glycine max. Sci Rep, 2016. 6: p. 31134 [PMID:27498784] Favero DS,Le KN,Neff MM Brassinosteroid signaling converges with SUPPRESSOR OF PHYTOCHROME B4-#3 to influence the expression of SMALL AUXIN UP RNA genes and hypocotyl growth. Plant J., 2017. 89(6): p. 1133-1145 [PMID:27984677] Li H, et al. BZR1 Positively Regulates Freezing Tolerance via CBF-Dependent and CBF-Independent Pathways in Arabidopsis. Mol Plant, 2017. 10(4): p. 545-559 [PMID:28089951] Zentella R, et al. The Arabidopsis O-fucosyltransferase SPINDLY activates nuclear growth repressor DELLA. Nat. Chem. Biol., 2017. 13(5): p. 479-485 [PMID:28244988] Espinosa-Ruiz A, et al. TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] Li QF, et al. Light involved regulation of BZR1 stability and phosphorylation status to coordinate plant growth in Arabidopsis. Biosci. Rep., 2018. [PMID:28396515] Thussagunpanit J, et al. Characterization of synthetic ecdysteroid analogues as functional mimics of brassinosteroids in plant growth. J. Steroid Biochem. Mol. Biol., 2017. 172: p. 1-8 [PMID:28479230] Zhu JY, et al. The F-box Protein KIB1 Mediates Brassinosteroid-Induced Inactivation and Degradation of GSK3-like Kinases in Arabidopsis. Mol. Cell, 2017. 66(5): p. 648-657.e4 [PMID:28575660] Yang M,Wang X Multiple Ways of BES1/BZR1 Degradation to Decode Distinct Developmental and Environmental Cues in Plants. Mol Plant, 2017. 10(7): p. 915-917 [PMID:28629641] Lv B, et al. Brassinosteroids regulate root growth by controlling reactive oxygen species homeostasis and dual effect on ethylene synthesis in Arabidopsis. PLoS Genet., 2018. 14(1): p. e1007144 [PMID:29324765] Ibañez C, et al. Brassinosteroids Dominate Hormonal Regulation of Plant Thermomorphogenesis via BZR1. Curr. Biol., 2018. 28(2): p. 303-310.e3 [PMID:29337075] Saito M,Kondo Y,Fukuda H BES1 and BZR1 Redundantly Promote Phloem and Xylem Differentiation. Plant Cell Physiol., 2018. 59(3): p. 590-600 [PMID:29385529] Li QF, et al. The brassinosteroid-regulated transcription factors BZR1/BES1 function as a coordinator in multisignal-regulated plant growth. Biochim Biophys Acta Gene Regul Mech, 2018. 1861(6): p. 561-571 [PMID:29673687] Nosaki S, et al. Structural basis for brassinosteroid response by BIL1/BZR1. Nat Plants, 2018. 4(10): p. 771-776 [PMID:30287951]