PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB

Protein Properties

Length: 191aa MW: 21920.7 Da PI: 8.3173

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.009G040900.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	62.6	8.1e-20	18	65	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd++l+++v+ +G+++W ++a++ g++R++k+c++rw++yl Gorai.009G040900.1 18 RGAWTDEEDQKLAQVVEIYGPKRWQAVAAKAGLNRSGKSCRLRWLNYL 65 89********************************************97 PP
2	Myb_DNA-binding	50.9	3.6e-16	71	116	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Gorai.009G040900.1 71 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 116 78999***************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	26.715	13	69	IPR017930	Myb domain
SuperFamily	SSF46689	8.44E-30	16	112	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-17	17	67	IPR001005	SANT/Myb domain
Pfam	PF00249	2.3E-19	18	65	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-24	19	72	IPR009057	Homeodomain-like
CDD	cd00167	3.60E-12	20	65	No hit	No description
SMART	SM00717	1.9E-15	70	118	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	20.215	70	120	IPR017930	Myb domain
Pfam	PF00249	1.5E-14	71	116	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.2E-24	73	119	IPR009057	Homeodomain-like
CDD	cd00167	3.34E-10	75	116	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 191 aa Download sequence Send to blast
MPVAPPISTK CSKKEVNRGA WTDEEDQKLA QVVEIYGPKR WQAVAAKAGL NRSGKSCRLR 60 WLNYLRPNIK RGNISDQEED LILRLHKLLG NRWSLIAGRL PGRTDNEIKN YWNSHLSKKT 120 KQNEKQTIGS RMQEPVLENC KVSESKRDEN STACFINGDD SLFDSYSEEP LNLEWTSHFF 180 ETDELWLNLA *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	3e-31	15	120	1	105	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	4e-31	15	120	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JX582297	2e-43	JX582297.1 Gossypium hirsutum clone NBRI_GE15106 microsatellite sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012442588.1	1e-140	PREDICTED: transcription factor MYB114-like isoform X1
Swissprot	P10290	2e-50	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	A0A0D2TDA6	1e-138	A0A0D2TDA6_GOSRA; Uncharacterized protein
STRING	Gorai.009G040900.1	1e-139	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13540.1	1e-51	myb domain protein 5

Link Out ? help Back to Top
Phytozome	Gorai.009G040900.1
Entrez Gene	105767566

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]