![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.008G179900.2 | ||||||||
Common Name | B456_008G179900 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 210aa MW: 24386.9 Da PI: 10.0674 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 177 | 5.2e-55 | 11 | 136 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lppGfrFhPtdeel+++yLk+++++k++++ ++i+evdiyk++Pw+Lp k++ +e+ewyfFs+rd+ky++g r+nrat sgyWkatg+dk+ Gorai.008G179900.2 11 LPPGFRFHPTDEELIMFYLKNQAKSKPCPV-SIIPEVDIYKFDPWQLPDKAEFGENEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKA 100 79****************************.89***************99999************************************** PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++s +++ vg+kk Lvfy+gr pkg+kt+W+mheyrl Gorai.008G179900.2 101 IHS-GSKYVGVKKALVFYNGRPPKGVKTNWIMHEYRL 136 ***.99*****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.85E-67 | 8 | 163 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 61.151 | 11 | 163 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-27 | 12 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009825 | Biological Process | multidimensional cell growth | ||||
GO:0009835 | Biological Process | fruit ripening | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 210 aa Download sequence Send to blast |
MERNTSSKSD LPPGFRFHPT DEELIMFYLK NQAKSKPCPV SIIPEVDIYK FDPWQLPDKA 60 EFGENEWYFF SPRDRKYPNG VRPNRATVSG YWKATGTDKA IHSGSKYVGV KKALVFYNGR 120 PPKGVKTNWI MHEYRLSDSH KQIKKHNGSM RLDDWVLCRI YKKKNSAEKI MDHKVEESNT 180 QIDRGLKMLR SYSLETYLTI TVPSQGIFK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-74 | 2 | 169 | 8 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-74 | 2 | 169 | 8 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-74 | 2 | 169 | 8 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-74 | 2 | 169 | 8 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-74 | 2 | 169 | 11 | 174 | NAC domain-containing protein 19 |
3swm_B | 2e-74 | 2 | 169 | 11 | 174 | NAC domain-containing protein 19 |
3swm_C | 2e-74 | 2 | 169 | 11 | 174 | NAC domain-containing protein 19 |
3swm_D | 2e-74 | 2 | 169 | 11 | 174 | NAC domain-containing protein 19 |
3swp_A | 2e-74 | 2 | 169 | 11 | 174 | NAC domain-containing protein 19 |
3swp_B | 2e-74 | 2 | 169 | 11 | 174 | NAC domain-containing protein 19 |
3swp_C | 2e-74 | 2 | 169 | 11 | 174 | NAC domain-containing protein 19 |
3swp_D | 2e-74 | 2 | 169 | 11 | 174 | NAC domain-containing protein 19 |
4dul_A | 2e-74 | 2 | 169 | 8 | 171 | NAC domain-containing protein 19 |
4dul_B | 2e-74 | 2 | 169 | 8 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00221 | DAP | Transfer from AT1G69490 | Download |
![]() |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012438548.1 | 1e-137 | PREDICTED: NAC transcription factor 29-like | ||||
Swissprot | K4BWV2 | 1e-104 | NAP1_SOLLC; NAC domain-containing protein 1 | ||||
TrEMBL | A0A0D2T814 | 1e-155 | A0A0D2T814_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.008G179900.1 | 1e-137 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 1e-105 | NAC-like, activated by AP3/PI |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.008G179900.2 |
Publications ? help Back to Top | |||
---|---|---|---|
|