PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB

Protein Properties

Length: 225aa MW: 25457.8 Da PI: 6.9835

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.008G158000.2	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51.1	3.2e-16	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WTteEd ll +++ ++G g W+ a++ g++R++k+c++rw++yl Gorai.008G158000.2 13 KGPWTTEEDTLLTRYIGRHGVGPWNMLAKCAGLKRSGKSCRLRWLNYL 60 79********************************************97 PP
2	Myb_DNA-binding	49.8	7.6e-16	66	109	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T +E++l+++++ ++G++ W++Ia++++ gRt++++k++w++ Gorai.008G158000.2 66 RGNLTLQEQQLILQLHSLWGNR-WSKIAEHLP-GRTDNEIKNYWRT 109 7899****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	12.519	8	60	IPR017930	Myb domain
SuperFamily	SSF46689	2.7E-30	11	107	IPR009057	Homeodomain-like
SMART	SM00717	3.6E-13	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	8.5E-14	13	60	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.9E-22	14	67	IPR009057	Homeodomain-like
CDD	cd00167	2.55E-10	15	60	No hit	No description
PROSITE profile	PS51294	24.804	61	115	IPR017930	Myb domain
SMART	SM00717	2.7E-14	65	113	IPR001005	SANT/Myb domain
Pfam	PF00249	8.4E-15	66	109	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.1E-22	68	114	IPR009057	Homeodomain-like
CDD	cd00167	1.98E-7	86	109	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 225 aa Download sequence Send to blast
MSTLIEEEIE VRKGPWTTEE DTLLTRYIGR HGVGPWNMLA KCAGLKRSGK SCRLRWLNYL 60 NPDIKRGNLT LQEQQLILQL HSLWGNRWSK IAEHLPGRTD NEIKNYWRTR VQNKQPSSSS 120 LKEMSSQFSV PCQLPECIVP SGSVINISQQ IEFPQHETSP NAYAHTCVDN NNLVLNGSYN 180 IGRSGQDMEA FRLASMSAVG EGCWICNEMT DSLWQCRELG EMGN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-26	13	114	7	107	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mainly expressed in floral tissues. expressed in all four whorls of the flower, in the anther vascular tissue and in cells at the junction between anther and stamen filaments. Detected in the nectaries and ovules. {ECO:0000269\|PubMed:16805732, ECO:0000269\|PubMed:19325888, ECO:0000269\|Ref.1}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in photomorphogenesis in the light. May act downstream of the light receptor network and directly affects transcription of light-induced genes. In darkness, its probable degradation prevent the activation of light-induced genes. Required to activate expression of PAL. Acts redundantly with MYB24 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB24 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269\|PubMed:11967090, ECO:0000269\|PubMed:16805732, ECO:0000269\|PubMed:19091873, ECO:0000269\|PubMed:19325888, ECO:0000269\|PubMed:21447791}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by jasmonate. {ECO:0000269\|PubMed:16805732}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012438236.1	1e-167	PREDICTED: myb-related protein 340-like isoform X2
Refseq	XP_016735933.1	1e-167	PREDICTED: myb-related protein 340-like isoform X2
Swissprot	Q9LK95	5e-57	MYB21_ARATH; Transcription factor MYB21
TrEMBL	A0A0D2T193	1e-166	A0A0D2T193_GOSRA; Uncharacterized protein
TrEMBL	A0A1U8ND98	1e-166	A0A1U8ND98_GOSHI; myb-related protein 340-like isoform X2
STRING	Gorai.008G158000.1	1e-143	(Gossypium raimondii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27810.1	2e-51	myb domain protein 21

Link Out ? help Back to Top
Phytozome	Gorai.008G158000.2
Entrez Gene	105764260

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Su Z, et al. Flower development under drought stress: morphological and transcriptomic analyses reveal acute responses and long-term acclimation in Arabidopsis. Plant Cell, 2013. 25(10): p. 3785-807 [PMID:24179129] Liu Z, et al. A Conserved Cytochrome P450 Evolved in Seed Plants Regulates Flower Maturation. Mol Plant, 2015. 8(12): p. 1751-65 [PMID:26388305] Chen X,Huang H,Qi T,Liu B,Song S New perspective of the bHLH-MYB complex in jasmonate-regulated plant fertility in arabidopsis. Plant Signal Behav, 2016. 11(2): p. e1135280 [PMID:26829586] Huang H, et al. Arabidopsis MYB24 Regulates Jasmonate-Mediated Stamen Development. Front Plant Sci, 2017. 8: p. 1525 [PMID:28928760]