![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.007G002200.3 | ||||||||
Common Name | B456_007G002200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 241aa MW: 28049.1 Da PI: 9.1745 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.2 | 4e-18 | 18 | 63 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed++l+d+v+++G+++W++Ia++++ gR++k+c++rw++ Gorai.007G002200.3 18 RGHWRPAEDDKLLDLVQRYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 63 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 56 | 9.2e-18 | 70 | 113 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++T+eE+e+l+ ++ +G++ W+ Iar ++ gRt++ +k++w+ Gorai.007G002200.3 70 RSPFTEEEEERLLASHRIHGNR-WSVIARLFP-GRTDNAVKNHWHV 113 789*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.069 | 13 | 64 | IPR017930 | Myb domain |
SMART | SM00717 | 9.5E-15 | 17 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.7E-18 | 18 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.31E-29 | 18 | 111 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.7E-27 | 19 | 71 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.00E-13 | 21 | 62 | No hit | No description |
PROSITE profile | PS51294 | 25.117 | 65 | 119 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-15 | 69 | 117 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-14 | 70 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.4E-21 | 72 | 118 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.72E-12 | 72 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 241 aa Download sequence Send to blast |
MGKAYLRFFI ANQQMCSRGH WRPAEDDKLL DLVQRYGPHN WNAIAEKLQG RSGKSCRLRW 60 FNQLDPRINR SPFTEEEEER LLASHRIHGN RWSVIARLFP GRTDNAVKNH WHVIMARRCR 120 RQRSSSKTLP PSTSTSTSTS HQHHITSTTL FPHNNYMHAF PPYSYFKHFY AHNPNPSLTT 180 TTQDTTQPTE FYDFLQVNTD SNESEVTDNT CKRDGEEVDQ EHQSRPAVPF FDFLSVPRSS 240 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1mse_C | 7e-34 | 15 | 119 | 1 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 7e-34 | 15 | 119 | 1 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in stamen (PubMed:19325888). Present in roots and siliques, and, at low levels, in leaves and flowers (PubMed:21399993). Expressed in stems, especially in fibers and, at lower levels, in xylems (PubMed:18952777, PubMed:21399993). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21399993}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00145 | DAP | Transfer from AT1G17950 | Download |
![]() |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX614947 | 1e-69 | JX614947.1 Gossypium hirsutum clone NBRI_GE58686 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012488371.1 | 1e-169 | PREDICTED: transcriptional activator Myb-like isoform X2 | ||||
Swissprot | Q6R0C4 | 4e-87 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A0D2S4B6 | 0.0 | A0A0D2S4B6_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.007G002200.1 | 1e-162 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17950.1 | 2e-81 | myb domain protein 52 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.007G002200.3 |
Publications ? help Back to Top | |||
---|---|---|---|
|