![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.006G274300.1 | ||||||||
Common Name | B456_006G274300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 176aa MW: 19852.4 Da PI: 10.4514 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.8 | 1.4e-14 | 98 | 143 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++WT+eE+ ++ + ++lG+g+W+ I++ + +Rt+ q+ s+ qky Gorai.006G274300.1 98 KPWTEEEHRTFLAGLRKLGKGDWRGISKSFVPTRTPTQVASHAQKY 143 58****************************99*************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50158 | 8.565 | 7 | 22 | IPR001878 | Zinc finger, CCHC-type |
PROSITE profile | PS51294 | 19.188 | 92 | 148 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.52E-17 | 94 | 148 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 8.4E-17 | 95 | 147 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 5.2E-11 | 96 | 146 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-12 | 98 | 143 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-12 | 98 | 142 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.31E-11 | 99 | 144 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MVKEAGRKCS HCGHNGHNSR TCYVHNSRCC NGKGGCVKLF GVKIGAMDQK RENVMKKSFS 60 MGNLQSHAEN NNDDDGYFSD GQIQSKKHKA SHERKRGKPW TEEEHRTFLA GLRKLGKGDW 120 RGISKSFVPT RTPTQVASHA QKYFLRQAGT DKKKRRPSLF DMEFQESGSV RYSLD* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 151 | 155 | KKKRR |
2 | 151 | 156 | KKKRRP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00573 | DAP | Transfer from AT5G61620 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012487667.1 | 1e-126 | PREDICTED: uncharacterized protein LOC105800854 isoform X1 | ||||
Swissprot | Q9FKF9 | 3e-61 | M5162_ARATH; Probable transcription factor At5g61620 | ||||
TrEMBL | A0A0D2QHP9 | 1e-129 | A0A0D2QHP9_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.006G274300.1 | 1e-129 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6021 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61620.1 | 1e-63 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.006G274300.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|