PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB

Protein Properties

Length: 239aa MW: 27516.2 Da PI: 8.2227

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.006G195700.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.2	1.3e-15	25	72	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv+ + +G +W+++++ g++R++k+c++rw +yl Gorai.006G195700.1 25 KGPWTAEEDKKLVNFMRTHGYYCWRAVPKLAGLRRCGKSCRLRWTNYL 72 79********************************************97 PP
2	Myb_DNA-binding	51.7	2e-16	83	122	6	47
HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +E++l +d++++lG++ W++Ia++++ gRt++++k++w+++ Gorai.006G195700.1 83 HDEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 122 68*************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	6.8E-22	16	73	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.301	20	72	IPR017930	Myb domain
SuperFamily	SSF46689	1.99E-27	22	119	IPR009057	Homeodomain-like
SMART	SM00717	5.0E-12	24	74	IPR001005	SANT/Myb domain
Pfam	PF00249	2.2E-14	25	72	IPR001005	SANT/Myb domain
CDD	cd00167	7.65E-9	27	72	No hit	No description
PROSITE profile	PS51294	26.538	73	127	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	4.3E-24	74	128	IPR009057	Homeodomain-like
SMART	SM00717	4.7E-14	77	125	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-14	83	122	IPR001005	SANT/Myb domain
CDD	cd00167	4.02E-10	84	123	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 239 aa Download sequence Send to blast
MVGVDWCKVR GMGRQPCCDK LGVKKGPWTA EEDKKLVNFM RTHGYYCWRA VPKLAGLRRC 60 GKSCRLRWTN YLRPDLKRGL LNHDEEQLVI DLHARLGNRW SKIAARLPGR TDNEIKNHWN 120 THIKKKLIKM GIDPVTHEPL QKPDTPQNKP NLDPNQPENL SKSCAHEFSL PTGPDKWRSS 180 WESDDDPSIN LIWPEAFLHD LSENFHGTDS WWKEYSEIGT SSKEETCFSW LVGDAGEQ*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-27	25	127	7	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in mature flowers and decreases upon pollination. {ECO:0000269\|PubMed:15805488}.
Uniprot	TISSUE SPECIFICITY: Restricted to the petals, with the highest expression in the limb. {ECO:0000269\|PubMed:15805488}.

Functional Description ? help Back to Top
Source	Description
UniProt	R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269\|PubMed:15805488}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EF651783	0.0	EF651783.1 Gossypium hirsutum transcription factor TF1 (TF1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012486460.1	1e-178	PREDICTED: protein ODORANT1-like
Swissprot	Q50EX6	2e-83	ODO1_PETHY; Protein ODORANT1
TrEMBL	A0A0D2T0Z3	1e-176	A0A0D2T0Z3_GOSRA; Uncharacterized protein
STRING	Gorai.006G195700.1	1e-177	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G22680.1	3e-86	myb domain protein 85

Link Out ? help Back to Top
Phytozome	Gorai.006G195700.1
Entrez Gene	105800095

Publications ? help Back to Top
Verdonk JC,Haring MA,van Tunen AJ,Schuurink RC ODORANT1 regulates fragrance biosynthesis in petunia flowers. Plant Cell, 2005. 17(5): p. 1612-24 [PMID:15805488] Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886]