PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB

Protein Properties

Length: 234aa MW: 26677 Da PI: 7.1694

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.006G118200.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	26.9	1.1e-08	24	70	3	47
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47 WT Ed+ + ++ +++ g +W++Ia+ ++ g+++k++ +++++ Gorai.006G118200.1 24 HWTRLEDKVFEQCLVLFPEGisdRWEKIAEQIP-GKSAKEVEQHFHML 70 5******************************.*********976 PP
2	Myb_DNA-binding	46.5	8.2e-15	123	167	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE++l++ + +++G+g+W++I+r + +Rt+ q+ s+ qky Gorai.006G118200.1 123 PWTEEEHKLFLIGLQKFGKGDWRSISRNVVVTRTPTQVASHAQKY 167 8*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	3.3E-6	21	73	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.73E-10	23	77	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.9E-5	24	68	IPR009057	Homeodomain-like
Pfam	PF00249	9.4E-8	24	70	IPR001005	SANT/Myb domain
PROSITE profile	PS50090	6.528	25	71	IPR017877	Myb-like domain
CDD	cd00167	2.01E-7	25	71	No hit	No description
PROSITE profile	PS51294	20.829	116	172	IPR017930	Myb domain
SuperFamily	SSF46689	6.35E-17	118	172	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	1.0E-17	119	171	IPR006447	Myb domain, plants
SMART	SM00717	4.7E-11	120	170	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.1E-11	120	166	IPR009057	Homeodomain-like
CDD	cd00167	1.44E-9	123	168	No hit	No description
Pfam	PF00249	9.1E-13	123	167	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 234 aa Download sequence Send to blast
MYQDNNHCNG DPLFIESVAA ASTHWTRLED KVFEQCLVLF PEGISDRWEK IAEQIPGKSA 60 KEVEQHFHML VYDVYEIDAG RVQVPQYADD SVMLSQGWDS QNQISFVSKS KHHGEGERKK 120 GTPWTEEEHK LFLIGLQKFG KGDWRSISRN VVVTRTPTQV ASHAQKYFLR QSAVKKERKR 180 SSIHDITTVD SKTMDVPVEQ NRGSEPHGMV QQAPQLQQIP HTGHFVGKYG YPM*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269\|PubMed:11937495}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269\|PubMed:11937495, ECO:0000269\|PubMed:9118809}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00055	PBM	Transfer from AT5G04760	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	-	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012485202.1	1e-176	PREDICTED: transcription factor DIVARICATA-like
Swissprot	Q8S9H7	3e-58	DIV_ANTMA; Transcription factor DIVARICATA
TrEMBL	A0A0D2Q884	1e-175	A0A0D2Q884_GOSRA; Uncharacterized protein
STRING	Gorai.006G118200.1	1e-176	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5127	27	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G04760.1	4e-85	MYB family protein

Link Out ? help Back to Top
Phytozome	Gorai.006G118200.1
Entrez Gene	105799285

Publications ? help Back to Top
Galego L,Almeida J Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers. Genes Dev., 2002. 16(7): p. 880-91 [PMID:11937495] Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Almeida J,Rocheta M,Galego L Genetic control of flower shape in Antirrhinum majus. Development, 1997. 124(7): p. 1387-92 [PMID:9118809]