![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.006G005100.1 | ||||||||
Common Name | B456_006G005100, LOC105798047 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 261aa MW: 30580.2 Da PI: 4.69 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 142.1 | 3.2e-44 | 28 | 153 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 p+G+rF+P+d+elv +yLk+k+ + +l+ + i++v++y+++P++L +k+ + +e+ewyfF++r+kky++g r+nr++ +gyWkatg dk Gorai.006G005100.1 28 PAGYRFKPRDDELVLFYLKPKLLNLRLPP-NRIRDVELYHYNPQQLIEKYGSyGEEEWYFFTPREKKYRNGLRPNRTAGDGYWKATGADKI 117 89************************999.77**************8544443889********************************988 PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + s +++++g +k Lvfykg+ pkgektdW+mhe+rl Gorai.006G005100.1 118 LRS-ESHEIGYRKALVFYKGKPPKGEKTDWMMHEFRL 153 777.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.89E-54 | 25 | 178 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 51.735 | 27 | 178 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.5E-24 | 28 | 153 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 261 aa Download sequence Send to blast |
MSNNFELGTT ENINNNEEDD EELLNSFPAG YRFKPRDDEL VLFYLKPKLL NLRLPPNRIR 60 DVELYHYNPQ QLIEKYGSYG EEEWYFFTPR EKKYRNGLRP NRTAGDGYWK ATGADKILRS 120 ESHEIGYRKA LVFYKGKPPK GEKTDWMMHE FRLKDPPAKL SQDEMRLDDW ILCKIYQKSD 180 KSTKNSALIS DNPQGVVSFE YGSDEFGEMD DNLYCDYLMF DHNPSLLLDD NFCDYYDPSL 240 IPMAMVEQGR MDSPDKKTTS * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-51 | 17 | 184 | 7 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-51 | 17 | 184 | 7 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-51 | 17 | 184 | 7 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-51 | 17 | 184 | 7 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-51 | 17 | 184 | 10 | 174 | NAC domain-containing protein 19 |
3swm_B | 5e-51 | 17 | 184 | 10 | 174 | NAC domain-containing protein 19 |
3swm_C | 5e-51 | 17 | 184 | 10 | 174 | NAC domain-containing protein 19 |
3swm_D | 5e-51 | 17 | 184 | 10 | 174 | NAC domain-containing protein 19 |
3swp_A | 5e-51 | 17 | 184 | 10 | 174 | NAC domain-containing protein 19 |
3swp_B | 5e-51 | 17 | 184 | 10 | 174 | NAC domain-containing protein 19 |
3swp_C | 5e-51 | 17 | 184 | 10 | 174 | NAC domain-containing protein 19 |
3swp_D | 5e-51 | 17 | 184 | 10 | 174 | NAC domain-containing protein 19 |
4dul_A | 4e-51 | 17 | 184 | 7 | 171 | NAC domain-containing protein 19 |
4dul_B | 4e-51 | 17 | 184 | 7 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed at the base of the inflorescence meristem and at late stages of development in petals and stamens. Up-regulated during leaf senescence. {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:9489703}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in senescing leaves, petals and sepals. {ECO:0000269|PubMed:16640597}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:25516602}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:24659488, ECO:0000269|PubMed:25516602, ECO:0000269|PubMed:9489703}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC847251 | 0.0 | KC847251.1 Gossypium hirsutum NAC domain protein NAC74 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001314257.1 | 0.0 | NAC transcription factor 29-like | ||||
Refseq | XP_012483385.1 | 0.0 | PREDICTED: NAC transcription factor 29-like | ||||
Swissprot | O49255 | 3e-55 | NAC29_ARATH; NAC transcription factor 29 | ||||
TrEMBL | A0A0D2RN18 | 0.0 | A0A0D2RN18_GOSRA; Uncharacterized protein | ||||
TrEMBL | W6J8U8 | 0.0 | W6J8U8_GOSHI; NAC domain protein NAC74 | ||||
STRING | Gorai.006G005100.1 | 0.0 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM24908 | 3 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 2e-54 | NAC-like, activated by AP3/PI |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.006G005100.1 |
Entrez Gene | 105798047 |