PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

bHLH

Protein Properties

Length: 94aa MW: 10648 Da PI: 9.3344

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.005G139900.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	23.4	1e-07	19	59	14	54
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 d+i + ++L+ l+P++ + + K+s + +L+++++YI+sL Gorai.005G139900.1 19 DQITDLVSKLQHLIPELRRRRFDKVSTSKVLQETCNYIRSL 59 6899999*******87999999*************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50888	10.15	5	59	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Pfam	PF00010	2.4E-5	19	59	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamily	SSF47459	1.13E-8	19	76	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Gene3D	G3DSA:4.10.280.10	4.3E-9	19	73	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MSGRRSRSKQ SSVSSITDDQ ITDLVSKLQH LIPELRRRRF DKVSTSKVLQ ETCNYIRSLH 60 REVEDLSDRL SQLLASTDSD SDQAAIIRSL LMQ*

Functional Description ? help Back to Top
Source	Description
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269\|PubMed:16786307, ECO:0000269\|PubMed:23224238}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269\|PubMed:16786307}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012478675.1	1e-58	PREDICTED: transcription factor PRE6-like
Refseq	XP_016691126.1	1e-58	PREDICTED: transcription factor PRE6-like
Swissprot	Q8GW32	9e-39	PRE6_ARATH; Transcription factor PRE6
TrEMBL	A0A0D2SGN6	3e-57	A0A0D2SGN6_GOSRA; Uncharacterized protein
TrEMBL	A0A1U8JLH0	3e-57	A0A1U8JLH0_GOSHI; transcription factor PRE6-like
TrEMBL	A0A2P5QDX7	3e-57	A0A2P5QDX7_GOSBA; Uncharacterized protein
STRING	Gorai.005G139900.1	5e-58	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM259	28	225

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G26945.1	7e-41	bHLH family protein

Link Out ? help Back to Top
Phytozome	Gorai.005G139900.1
Entrez Gene	105794180

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Gommers CM, et al. Molecular Profiles of Contrasting Shade Response Strategies in Wild Plants: Differential Control of Immunity and Shoot Elongation. Plant Cell, 2017. 29(2): p. 331-344 [PMID:28138015] Sanz-Fernández M, et al. Screening Arabidopsis mutants in genes useful for phytoremediation. J. Hazard. Mater., 2017. 335: p. 143-151 [PMID:28441590] Zheng K, et al. Involvement of PACLOBUTRAZOL RESISTANCE6/KIDARI, an Atypical bHLH Transcription Factor, in Auxin Responses in Arabidopsis. Front Plant Sci, 2017. 8: p. 1813 [PMID:29114256]