 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Gorai.003G035400.1 |
Common Name | B456_003G035400 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
Family |
HD-ZIP |
Protein Properties |
Length: 99aa MW: 11597.3 Da PI: 9.9492 |
Description |
HD-ZIP family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Gorai.003G035400.1 | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Homeobox | 62.3 | 7e-20 | 20 | 73 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
k+++++ +q+++Le+ F +++ e++ +LA++lgL+ rqV +WFqNrRa++k
Gorai.003G035400.1 20 KKRRLSMHQVKALEKNFDVGNKLEPERKVKLAEELGLQPRQVAIWFQNRRARWK 73
56689************************************************9 PP
|
2 | HD-ZIP_I/II | 111 | 8e-36 | 19 | 89 | 1 | 71 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkrayd 71
ekkrrls +qvk+LE++F+ +kLeperKv+la+eLglqprqva+WFqnrRAR+ktk lEkdy++Lk++ +
Gorai.003G035400.1 19 EKKRRLSMHQVKALEKNFDVGNKLEPERKVKLAEELGLQPRQVAIWFQNRRARWKTKVLEKDYAMLKANRE 89
69*****************************************************************9876 PP
|
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | DEVELOPMENTAL STAGE: Localized primarily to the hypocotyl of germinating seedlings. {ECO:0000269|PubMed:12678559}. |
Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor that acts as a positive regulator of ABA-responsiveness, mediating the inhibitory effect of ABA on growth during seedling establishment. Binds to the DNA sequence 5'-CAATNATTG-3'. {ECO:0000269|PubMed:12678559}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Down-regulated by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:12678559, ECO:0000269|PubMed:16055682}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AC243121 | 1e-156 | AC243121.1 Gossypium raimondii clone GR__Ba0142D21-hnv, complete sequence. |
Publications
? help Back to Top |
- Paterson AH, et al.
Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] - Cassan-Wang H, et al.
Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Song L, et al.
A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] - Stamm P, et al.
The Transcription Factor ATHB5 Affects GA-Mediated Plasticity in Hypocotyl Cell Growth during Seed Germination. Plant Physiol., 2017. 173(1): p. 907-917 [PMID:27872245]
|