PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB

Protein Properties

Length: 253aa MW: 28472 Da PI: 5.4366

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.003G021100.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.2	1.4e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+ Ed+ll ++++++G g+W+t +++ g++R++k+c++rw +yl Gorai.003G021100.1 14 RGAWSVKEDQLLSNYINLHGEGQWRTLPQKAGLNRCGKSCRLRWMNYL 61 89********************************************97 PP
2	Myb_DNA-binding	51.1	3.2e-16	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ +++E++l+++++++lG++ W++Ia +++ gRt++++k++w++ Gorai.003G021100.1 67 RGNISPDEEDLIIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTI 111 7899****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.7E-21	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.416	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	9.38E-29	12	108	IPR009057	Homeodomain-like
SMART	SM00717	1.6E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.0E-14	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	3.33E-9	16	61	No hit	No description
PROSITE profile	PS51294	25.002	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	9.3E-25	65	115	IPR009057	Homeodomain-like
SMART	SM00717	8.9E-16	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	6.9E-15	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	6.16E-12	71	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 253 aa Download sequence Send to blast
MGRKPCCLKE GVNRGAWSVK EDQLLSNYIN LHGEGQWRTL PQKAGLNRCG KSCRLRWMNY 60 LRPGIKRGNI SPDEEDLIIR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT ILSKKSNADV 120 SKKTSESEDM KSVGKYLSAG ISTPVVPKAT RCTKIFFSSD EVDQHLKNDQ CPPLSTPTDT 180 DDGLTLESSK DDDVPDMDNA LDHVGFLQNG IADVFENSNM LESDKLAPMF ETKFNNDLSS 240 LLEFEDDWTN FL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-24	14	115	7	107	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JX589681	2e-65	JX589681.1 Gossypium hirsutum clone NBRI_GE24426 microsatellite sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012472580.1	0.0	PREDICTED: anthocyanin regulatory C1 protein-like
Swissprot	P10290	4e-63	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	A0A0D2NV60	0.0	A0A0D2NV60_GOSRA; Uncharacterized protein
STRING	Gorai.003G021100.1	0.0	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM24306	3	4

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47460.1	1e-61	myb domain protein 12

Link Out ? help Back to Top
Phytozome	Gorai.003G021100.1

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]