PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

MYB

Protein Properties

Length: 224aa MW: 25458.8 Da PI: 9.2291

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.20G013000.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.7	9.7e-17	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+++Ed++lvd++k++G +W+t ++ g++R++k+c++rw +yl Glyma.20G013000.1.p 13 KGAWSKQEDQKLVDYIKKHGEVCWRTLPQAAGLHRCGKSCRLRWINYL 60 79****************99**********************97 PP
2	Myb_DNA-binding	51.5	2.3e-16	66	110	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++ Glyma.20G013000.1.p 66 RGNFAEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSH 110 8999****************.*****.*********987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.68	8	60	IPR017930	Myb domain
SuperFamily	SSF46689	5.86E-28	11	107	IPR009057	Homeodomain-like
SMART	SM00717	1.4E-13	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	4.0E-14	13	60	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	9.8E-22	14	67	IPR009057	Homeodomain-like
CDD	cd00167	3.93E-10	15	60	No hit	No description
PROSITE profile	PS51294	26.297	61	115	IPR017930	Myb domain
SMART	SM00717	4.1E-15	65	113	IPR001005	SANT/Myb domain
Pfam	PF00249	7.1E-15	66	110	IPR001005	SANT/Myb domain
CDD	cd00167	1.32E-10	68	111	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.0E-25	68	116	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 224 aa Download sequence Send to blast
MRKPSCDIKE LNKGAWSKQE DQKLVDYIKK HGEVCWRTLP QAAGLHRCGK SCRLRWINYL 60 RPDLKRGNFA EDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH IRKKLISNGI 120 DPNNHRLNHT IPSVYQNPPM SDDSSKHFGM KDNNSKNETS KSPRVYNHGE VSDAASGEAE 180 SSCALPDLNL DLSICEKNLK PFHESKLSRK VPFDSPSTLL LFQ*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-29	8	115	2	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269\|PubMed:1840903}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, flowers and siliques. {ECO:0000269\|PubMed:9839469}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, seed pods and flowers. {ECO:0000269\|PubMed:1840903}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Function -- GeneRIF ? help Back to Top
R2R3 MYB gene GmMYB3a negatively regulates salt-stress response in soybean. [GmMYB3a] [PMID: 29524418]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.20G013000.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KT699108	1e-111	KT699108.1 Trifolium repens MYB133 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003556646.1	1e-166	transcription factor MYB3
Refseq	XP_028221328.1	1e-166	transcription factor MYB3-like
Swissprot	P81393	9e-73	MYB08_ANTMA; Myb-related protein 308
Swissprot	Q9S9K9	1e-72	MYB3_ARATH; Transcription factor MYB3
TrEMBL	A0A0B2RG93	1e-164	A0A0B2RG93_GLYSO; Myb-related protein 308
TrEMBL	K7N0Q3	1e-164	K7N0Q3_SOYBN; Uncharacterized protein
STRING	GLYMA20G01610.2	1e-165	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF264	34	221
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	5e-75	myb domain protein 3

Link Out ? help Back to Top
Phytozome	Glyma.20G013000.1.p
Entrez Gene	100818783

Publications ? help Back to Top
Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C Expression patterns of myb genes from Antirrhinum flowers. Plant Cell, 1991. 3(2): p. 115-25 [PMID:1840903] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] He Y, et al. Overexpression of a novel transcriptional repressor GmMYB3a negatively regulates salt-alkali tolerance and stress-related genes in soybean. Biochem. Biophys. Res. Commun., 2018. 498(3): p. 586-591 [PMID:29524418]