PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G191700.1.p
Common NameGLYMA_19G191700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HSF
Protein Properties Length: 100aa    MW: 11108.6 Da    PI: 6.5046
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G191700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind66.84.6e-213592360
                         HHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
         HSF_DNA-bind  3 lkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                          +k++++++d++l+ +isw ++g sfvv+d++ fa++vLp+ Fkh+nf+SFvR Ln+Y
  Glyma.19G191700.1.p 35 FSKTFDLVDDPSLDPIISWGSSGVSFVVWDRTLFARHVLPRNFKHNNFSSFVRLLNTY 92
                         589******************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.0E-212992IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004153.6E-153099IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.29E-203292IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000562.9E-113457IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.7E-173692IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.9E-117284IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.9E-118597IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MSSSQLPSSS PDFETVNSLP RPLECLQGNP VPALFSKTFD LVDDPSLDPI ISWGSSGVSF  60
VVWDRTLFAR HVLPRNFKHN NFSSFVRLLN TYVGTLYVF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A1e-1631921778Heat shock factor protein 1
5d5u_B2e-1631922687Heat shock factor protein 1
5d5v_B2e-1631922687Heat shock factor protein 1
5d5v_D2e-1631922687Heat shock factor protein 1
5hdg_A1e-163192768Heat shock factor protein 1
5hdn_A1e-163192768Heat shock factor protein 1
5hdn_B1e-163192768Heat shock factor protein 1
5hdn_C1e-163192768Heat shock factor protein 1
5hdn_D1e-163192768Heat shock factor protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress response. Activated by DREB2A under heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.19G191700.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0961332e-94BT096133.1 Soybean clone JCVI-FLGm-15K24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028225969.13e-43heat stress transcription factor A-3-like
SwissprotQ8GYY12e-33HSFA3_ARATH; Heat stress transcription factor A-3
TrEMBLK7MZ656e-65K7MZ65_SOYBN; Uncharacterized protein
STRINGGLYMA19G37585.11e-65(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15923395
Representative plantOGRP9617233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03720.16e-27heat shock transcription factor A3
Publications ? help Back to Top
  1. Jung HS, et al.
    Subset of heat-shock transcription factors required for the early response of Arabidopsis to excess light.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(35): p. 14474-9
    [PMID:23918368]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nie S,Yue H,Xing D
    A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance.
    Plant Physiol., 2016.
    [PMID:26099269]
  4. Hu Z, et al.
    Histone acetyltransferase GCN5 is essential for heat stress-responsive gene activation and thermotolerance in Arabidopsis.
    Plant J., 2015. 84(6): p. 1178-91
    [PMID:26576681]
  5. Song C,Chung WS,Lim CO
    Overexpression of Heat Shock Factor Gene HsfA3 Increases Galactinol Levels and Oxidative Stress Tolerance in Arabidopsis.
    Mol. Cells, 2016. 39(6): p. 477-83
    [PMID:27109422]
  6. Kim GD,Cho YH,Lee BH,Yoo SD
    STABILIZED1 Modulates Pre-mRNA Splicing for Thermotolerance.
    Plant Physiol., 2017. 173(4): p. 2370-2382
    [PMID:28223317]
  7. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]