![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.19G191700.1.p | ||||||||
Common Name | GLYMA_19G191700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 100aa MW: 11108.6 Da PI: 6.5046 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 66.8 | 4.6e-21 | 35 | 92 | 3 | 60 |
HHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 3 lkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 +k++++++d++l+ +isw ++g sfvv+d++ fa++vLp+ Fkh+nf+SFvR Ln+Y Glyma.19G191700.1.p 35 FSKTFDLVDDPSLDPIISWGSSGVSFVVWDRTLFARHVLPRNFKHNNFSSFVRLLNTY 92 589******************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.0E-21 | 29 | 92 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 3.6E-15 | 30 | 99 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 1.29E-20 | 32 | 92 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 2.9E-11 | 34 | 57 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 1.7E-17 | 36 | 92 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.9E-11 | 72 | 84 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.9E-11 | 85 | 97 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
MSSSQLPSSS PDFETVNSLP RPLECLQGNP VPALFSKTFD LVDDPSLDPI ISWGSSGVSF 60 VVWDRTLFAR HVLPRNFKHN NFSSFVRLLN TYVGTLYVF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ldu_A | 1e-16 | 31 | 92 | 17 | 78 | Heat shock factor protein 1 |
5d5u_B | 2e-16 | 31 | 92 | 26 | 87 | Heat shock factor protein 1 |
5d5v_B | 2e-16 | 31 | 92 | 26 | 87 | Heat shock factor protein 1 |
5d5v_D | 2e-16 | 31 | 92 | 26 | 87 | Heat shock factor protein 1 |
5hdg_A | 1e-16 | 31 | 92 | 7 | 68 | Heat shock factor protein 1 |
5hdn_A | 1e-16 | 31 | 92 | 7 | 68 | Heat shock factor protein 1 |
5hdn_B | 1e-16 | 31 | 92 | 7 | 68 | Heat shock factor protein 1 |
5hdn_C | 1e-16 | 31 | 92 | 7 | 68 | Heat shock factor protein 1 |
5hdn_D | 1e-16 | 31 | 92 | 7 | 68 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress response. Activated by DREB2A under heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.19G191700.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT096133 | 2e-94 | BT096133.1 Soybean clone JCVI-FLGm-15K24 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028225969.1 | 3e-43 | heat stress transcription factor A-3-like | ||||
Swissprot | Q8GYY1 | 2e-33 | HSFA3_ARATH; Heat stress transcription factor A-3 | ||||
TrEMBL | K7MZ65 | 6e-65 | K7MZ65_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA19G37585.1 | 1e-65 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1592 | 33 | 95 | Representative plant | OGRP96 | 17 | 233 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G03720.1 | 6e-27 | heat shock transcription factor A3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.19G191700.1.p |