PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

MYB_related

Protein Properties

Length: 159aa MW: 18735.4 Da PI: 9.9072

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.19G085700.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59	1.1e-18	30	73	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r+++T+eE+e+l+ ++ +G++ W+ Iar+++ gRt++ +k++w+ Glyma.19G085700.1.p 30 RNPFTEEEEERLLASHRIHGNR-WAVIARHFP-GRTDNAVKNHWHV 73 789*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.35E-22	13	79	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	6.2E-9	14	37	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.25	25	79	IPR017930	Myb domain
SMART	SM00717	2.0E-16	29	77	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-15	30	72	IPR001005	SANT/Myb domain
CDD	cd00167	2.09E-12	32	72	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.4E-18	38	73	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 159 aa Download sequence Send to blast
MWLYSPEFEG IIWKSCRLRW FNQLDPRINR NPFTEEEEER LLASHRIHGN RWAVIARHFP 60 GRTDNAVKNH WHVIMARIRR ERSKINNPKL QPLFAPNLKD DLEAIPSFVE KYYEKYSHPC 120 VTLTHSSFQF PGKKFYFQDP SSAGSTVPPV SIAERKEL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-20	3	77	32	106	B-MYB
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Gma.52526	0.0	flower

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in stamen (PubMed:19325888). Present in roots and siliques, and, at low levels, in leaves and flowers (PubMed:21399993). Expressed in stems, especially in fibers and, at lower levels, in xylems (PubMed:18952777, PubMed:21399993). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:19325888, ECO:0000269\|PubMed:21399993}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.19G085700.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT092893	0.0	BT092893.1 Soybean clone JCVI-FLGm-12J9 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025982841.1	1e-101	transcription factor MYB21-like
Swissprot	Q6R0C4	2e-42	MYB52_ARATH; Transcription factor MYB52
TrEMBL	A0A445KE36	1e-114	A0A445KE36_GLYSO; Transcription factor MYB52
TrEMBL	K7MXB7	1e-114	K7MXB7_SOYBN; Uncharacterized protein
STRING	GLYMA19G24770.2	1e-115	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF230	34	243
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17950.1	1e-44	myb domain protein 52

Link Out ? help Back to Top
Phytozome	Glyma.19G085700.1.p

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]