![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.18G151400.1.p | ||||||||
Common Name | GLYMA_18G151400, LOC100809813, PHAN4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 353aa MW: 40286.1 Da PI: 10.0115 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.2 | 1.3e-15 | 4 | 53 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48 r+rW +eEd ll +vkq+G++ W++++++m+ ++R +k+c +rw +yl Glyma.18G151400.1.p 4 RQRWRAEEDALLCSYVKQYGPREWNLVSQRMNtpLNRDAKSCLERWKNYL 53 89**********************************************97 PP | |||||||
2 | Myb_DNA-binding | 35.6 | 2.1e-11 | 59 | 103 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k + +w + Glyma.18G151400.1.p 59 KGSLTEEEQRLVIRLQAKYGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103 6788******************.*********.*****999999766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.196 | 1 | 53 | IPR017930 | Myb domain |
SMART | SM00717 | 8.5E-13 | 3 | 55 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.07E-21 | 4 | 98 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.33E-8 | 6 | 53 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 8.0E-21 | 6 | 60 | IPR009057 | Homeodomain-like |
Pfam | PF13921 | 6.9E-15 | 7 | 67 | No hit | No description |
PROSITE profile | PS51294 | 23.786 | 54 | 108 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-10 | 58 | 106 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.3E-15 | 61 | 102 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.07E-7 | 63 | 104 | No hit | No description |
Gene3D | G3DSA:3.30.70.360 | 7.3E-4 | 258 | 339 | IPR011650 | Peptidase M20, dimerisation domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 353 aa Download sequence Send to blast |
MKERQRWRAE EDALLCSYVK QYGPREWNLV SQRMNTPLNR DAKSCLERWK NYLKPDIKKG 60 SLTEEEQRLV IRLQAKYGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE KKDVNRISDP 120 INNSKYEHIL ESFAEKLVKE RPSPSFLMAA SNGAFLHTDT PAPASSLLPS WLSNSSSPAA 180 DGPSSLSVTL SLSSSMVIAP PFSWLPPKRG PDNAPFVLGN AAALQGVIPT LSDNMLMSQM 240 VEHRKELEEG HRALGTHKKE AAWRLSRVEL QLESEKTNRR REKIEEFEAK IKALQEEELA 300 ALGRIEAEYR EQLDALRRDA ENKEQKLAEQ WAAKHLRLTR LLEQLGCRAG LP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 3e-17 | 7 | 92 | 7 | 89 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 3e-17 | 7 | 92 | 7 | 89 | C-Myb DNA-Binding Domain |
1msf_C | 3e-17 | 7 | 92 | 7 | 89 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.18698 | 0.0 | hypocotyl| somatic embryo |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Preferential expression in young and immature plant tissues. In embryos, expressed from the late globular stage onwards. After germination, detected in leaf founder cells and on flowering, in primordia of all floral organs. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, flowers, siliques and in lateral organ promordia (PubMed:17559509). Found in the inner domain between the adaxial and abaxial domains of leaves (PubMed:17559509). Expressed in the phloem tissues of leaves, cotyledons, hypocotyls, and roots (PubMed:21950734). {ECO:0000269|PubMed:17559509, ECO:0000269|PubMed:21950734}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for normal cell differentiation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 2 (LBD6/AS2) to repress the knox homeobox genes BP/KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3/ETT, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11076771, PubMed:11140682, PubMed:11882937, PubMed:12750468, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509, PubMed:23271976). Binds directly to KNAT1, KNAT2, and KNATM chromatin, regulating leaf development (PubMed:23271976). LBD6 is required for this binding (PubMed:23271976). Positive regulator of flowering that binds to the promoter of FT (PubMed:21950734). Regulates FT expression by forming a functional complex with CO (PubMed:21950734). Involved in leaf polarity establishment by functioning cooperatively with NUCL1 to repress abaxial genes ARF3, ARF4, KAN1, KAN2, YAB1 and YAB5, and the knox homeobox genes KNAT1, KNAT2, KNAT6, and STM to promote adaxial development in leaf primordia at shoot apical meristems at high temperatures (PubMed:27334696). {ECO:0000269|PubMed:11076771, ECO:0000269|PubMed:11140682, ECO:0000269|PubMed:11882937, ECO:0000269|PubMed:12750468, ECO:0000269|PubMed:16006579, ECO:0000269|PubMed:16699177, ECO:0000269|PubMed:17395603, ECO:0000269|PubMed:17559509, ECO:0000269|PubMed:23271976, ECO:0000269|PubMed:27334696}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.18G151400.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation with an afternoon peak in long days and with a broad night peak in short days (PubMed:21950734). Expression of AS1 in stem cells of the shoot apical meristem is prevented by SHOOT MERISTEMLESS (STM). Expression is activated by GTE6 during leaf morphogenesis (PubMed:16166385). {ECO:0000269|PubMed:16166385, ECO:0000269|PubMed:21950734}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC737843 | 0.0 | KC737843.1 Glycine max PHAN4 (PHAN4) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001304446.1 | 0.0 | transcription factor AS1-like | ||||
Refseq | XP_014626725.1 | 0.0 | transcription factor AS1-like isoform X1 | ||||
Refseq | XP_014626726.1 | 0.0 | transcription factor AS1-like isoform X1 | ||||
Refseq | XP_014626727.1 | 0.0 | transcription factor AS1-like isoform X1 | ||||
Refseq | XP_028212681.1 | 0.0 | transcription factor AS1-like | ||||
Refseq | XP_028212682.1 | 0.0 | transcription factor AS1-like | ||||
Refseq | XP_028212683.1 | 0.0 | transcription factor AS1-like | ||||
Swissprot | O80931 | 1e-140 | AS1_ARATH; Transcription factor AS1 | ||||
TrEMBL | A0A0B2SI54 | 0.0 | A0A0B2SI54_GLYSO; Transcription factor AS1 | ||||
TrEMBL | I1N1S3 | 0.0 | I1N1S3_SOYBN; PHAN4 | ||||
STRING | GLYMA18G26600.1 | 0.0 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2597 | 33 | 69 |
Representative plant | OGRP5096 | 14 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37630.1 | 1e-120 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.18G151400.1.p |
Entrez Gene | 100809813 |