PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

MYB

Protein Properties

Length: 198aa MW: 22884.7 Da PI: 7.454

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.17G143600.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	62.7	7.3e-20	18	65	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd +l+++++ +G ++Wkt+a + g++R++k+c++rw++yl Glyma.17G143600.1.p 18 RGAWTPEEDRKLAQCIEIHGAKRWKTVAIKSGLNRCGKSCRLRWLNYL 65 89********************************************97 PP
2	Myb_DNA-binding	52.2	1.4e-16	71	116	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + eE++l+++++++lG++ W++Ia +++ gRt++++k++w+++l Glyma.17G143600.1.p 71 RGNISDEEEDLILRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 116 7899****************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.074	13	69	IPR017930	Myb domain
SuperFamily	SSF46689	2.46E-29	16	112	IPR009057	Homeodomain-like
SMART	SM00717	3.6E-16	17	67	IPR001005	SANT/Myb domain
Pfam	PF00249	6.8E-18	18	65	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.2E-24	19	72	IPR009057	Homeodomain-like
CDD	cd00167	2.01E-11	20	65	No hit	No description
PROSITE profile	PS51294	20.161	70	120	IPR017930	Myb domain
SMART	SM00717	5.0E-14	70	118	IPR001005	SANT/Myb domain
Pfam	PF00249	4.9E-15	71	116	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.1E-25	73	121	IPR009057	Homeodomain-like
CDD	cd00167	9.31E-11	75	116	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009957	Biological Process	epidermal cell fate specification
GO:0010090	Biological Process	trichome morphogenesis
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048481	Biological Process	plant ovule development
GO:0048629	Biological Process	trichome patterning
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 198 aa Download sequence Send to blast
MAPRVNDGTI TSKRAMNRGA WTPEEDRKLA QCIEIHGAKR WKTVAIKSGL NRCGKSCRLR 60 WLNYLRPNIK RGNISDEEED LILRLHRLLG NRWSLIAGRL PGRTDNEIKN YWNSHLCKKV 120 NQKVEKPESY TRHEIIGQND AGDNRAMSEN EVEINESSNL DVSSFDVNEF FNFSEESFGF 180 DWLNKYLELD QIPQSTE*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-28	16	121	5	109	B-MYB
1h8a_C	3e-28	16	120	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.17G143600.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB490776	1e-112	AB490776.1 Lotus japonicus LjPAP mRNA for R2R3-MYB transcription factor LjPAP, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003549924.1	1e-145	transcription factor MYB114
Swissprot	P10290	4e-50	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	I1MV35	1e-144	I1MV35_SOYBN; Uncharacterized protein
STRING	GLYMA17G15270.1	1e-145	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2148	32	88
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13540.1	3e-51	myb domain protein 5

Link Out ? help Back to Top
Phytozome	Glyma.17G143600.1.p
Entrez Gene	100811754

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]