 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Glyma.17G100000.1.p |
Common Name | GLYMA_17G100000 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
Family |
ZF-HD |
Protein Properties |
Length: 80aa MW: 8531.66 Da PI: 8.8534 |
Description |
ZF-HD family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Glyma.17G100000.1.p | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | ZF-HD_dimer | 96 | 3.1e-30 | 21 | 75 | 3 | 58 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
++rY eC+kNhAa++Gg+avDGC+Efm+s egt aal+CaACgCHRnFH+rev
Glyma.17G100000.1.p 21 NIRYGECQKNHAANTGGYAVDGCREFMAS-ACEGTNAALTCAACGCHRNFHKREVL 75
689*************************9.8889*******************975 PP
|
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots, stems and flowers, present in seedlings and leaves, and weakly observed in inflorescence and siliques. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:18713354}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AC235246 | 1e-131 | AC235246.1 Glycine max strain Williams 82 clone GM_WBb0033G13, complete sequence. |
GenBank | BT096516 | 1e-131 | BT096516.1 Soybean clone JCVI-FLGm-9P8 unknown mRNA. |