![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.16G054400.1.p | ||||||||
Common Name | LOC100788382 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 196aa MW: 21519.8 Da PI: 9.2069 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 104.3 | 6.4e-33 | 116 | 174 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H+h+ Glyma.16G054400.1.p 116 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGVHTHP 174 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.1E-33 | 101 | 174 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.28E-30 | 108 | 175 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.895 | 111 | 176 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.5E-39 | 116 | 175 | IPR003657 | WRKY domain |
Pfam | PF03106 | 7.5E-27 | 117 | 174 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
GO:0010055 | Biological Process | atrichoblast differentiation | ||||
GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 196 aa Download sequence Send to blast |
MENYSMLFPI SNSSSYPIST SGVGSSQIGY NGQSSNAFLG LRPSNELLGS DDHDNGGEGG 60 GDGDGNMLMS QISGGSNTNV SDELGGSGNS NNKKKGEKKV KKPRYAFQTR SQVDILDDGY 120 RWRKYGQKAV KNNKFPRSYY RCTHQGCNVK KQVQRLTKDE GVVVTTYEGV HTHPIEKTTD 180 NFEHILSQMK IYTPF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-27 | 107 | 173 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-27 | 107 | 173 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.53222 | 0.0 | leaf |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00506 | DAP | Transfer from AT5G13080 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.16G054400.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT098641 | 0.0 | BT098641.1 Soybean clone JCVI-FLGm-12D20 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003549123.1 | 1e-144 | probable WRKY transcription factor 75 | ||||
Refseq | XP_028206193.1 | 1e-144 | probable WRKY transcription factor 75 | ||||
TrEMBL | A0A368UGZ1 | 1e-142 | A0A368UGZ1_SOYBN; Uncharacterized protein | ||||
TrEMBL | A0A445GER8 | 1e-142 | A0A445GER8_GLYSO; Putative WRKY transcription factor 75 | ||||
STRING | GLYMA16G05880.1 | 1e-143 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1156 | 34 | 110 |
Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 2e-58 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.16G054400.1.p |
Entrez Gene | 100788382 |