PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

SBP

Protein Properties

Length: 139aa MW: 16100.6 Da PI: 6.8638

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.15G076200.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	138.5	1.9e-43	57	133	2	78
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cqv+gC+adlseak yhrrhkvCe h+kap+vl+ +++qrfCqqCsrfhelsefD++krsCrrrLa+hnerrrk+++ Glyma.15G076200.1.p 57 CQVDGCSADLSEAKPYHRRHKVCEYHAKAPAVLIGDQHQRFCQQCSRFHELSEFDDSKRSCRRRLAGHNERRRKNAS 133 **************************************************************************875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF037575	2.0E-57	3	138	IPR017238	Squamosa promoter-binding protein
Gene3D	G3DSA:4.10.1100.10	1.6E-36	50	118	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	32.624	54	131	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.7E-39	55	135	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	2.2E-34	57	130	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009908	Biological Process	flower development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046872	Molecular Function	metal ion binding

Sequence ? help Back to Top
Protein Sequence Length: 139 aa Download sequence Send to blast
MDESWSEGKR SMSYKEEDEY EEEEEEEVSE YRDDGRKKKV VSSKRGSKAG GSVPPSCQVD 60 GCSADLSEAK PYHRRHKVCE YHAKAPAVLI GDQHQRFCQQ CSRFHELSEF DDSKRSCRRR 120 LAGHNERRRK NASEYHEL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	8e-37	49	130	3	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.15G076200.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015038	5e-77	AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003547153.1	1e-96	squamosa promoter-binding protein 1
Refseq	XP_028203202.1	1e-96	squamosa promoter-binding protein 1-like
Swissprot	Q38741	2e-47	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	A0A0B2QTJ6	3e-95	A0A0B2QTJ6_GLYSO; Squamosa promoter-binding-like protein
TrEMBL	I1MEK9	3e-95	I1MEK9_SOYBN; Squamosa promoter-binding-like protein
STRING	GLYMA15G08270.1	4e-96	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF535	34	153
Representative plant	OGRP97	17	230

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33810.1	3e-40	squamosa promoter binding protein-like 3

Link Out ? help Back to Top
Phytozome	Glyma.15G076200.1.p
Entrez Gene	100817597

Publications ? help Back to Top
Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]