![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.15G049000.2.p | ||||||||
Common Name | GLYMA_15G049000 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 120aa MW: 13430.5 Da PI: 7.5085 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 51.2 | 2.8e-16 | 49 | 90 | 4 | 45 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 l+++rr++kNRe+A rsR+RK+a++ eLe v Le+eN L Glyma.15G049000.2.p 49 LQKQRRMIKNRESAARSRERKQAYTVELESLVTHLEEENAVL 90 89*************************************876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 8.7E-13 | 46 | 109 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.025 | 48 | 90 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 7.5E-15 | 48 | 90 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.38E-12 | 50 | 92 | No hit | No description |
CDD | cd14707 | 2.94E-19 | 50 | 101 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 6.4E-15 | 51 | 92 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 53 | 68 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MAEVVAGTES EDNMSMSLQD LLGSHSHGGR RVKRKSVVEE PLVVDKVTLQ KQRRMIKNRE 60 SAARSRERKQ AYTVELESLV THLEEENAVL LQLAVCMYLS IYAFSVLSCL YNILFSLVG* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.15G049000.2.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT092284 | 1e-104 | BT092284.1 Soybean clone JCVI-FLGm-10F13 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003547064.1 | 1e-60 | G-box-binding factor 4 | ||||
Swissprot | Q0JHF1 | 1e-17 | BZP12_ORYSJ; bZIP transcription factor 12 | ||||
TrEMBL | I1MDS3 | 2e-80 | I1MDS3_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA15G05440.1 | 4e-60 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G44080.1 | 2e-21 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.15G049000.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|