PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Glyma.13G311200.7.p

Common Name

GLYMA_13G311200, LOC100815973

Organism

Glycine max

Taxonomic ID

3847

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

YABBY

Protein Properties

Length: 132aa MW: 14873.6 Da PI: 9.9257

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.13G311200.7.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	145.1	7.4e-45	11	108	72	170
YABBY 72 leelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWa 161 +++++ ++++l++++ +++ +s + +++++ ++++ pr+pp irPPekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWa Glyma.13G311200.7.p 11 QDTTQLQRQHLSVQEACSKELGSSSKCKTFETVDHDQQPRIPP-IRPPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWA 99 6778888999998888888888888888888888999999999.9******************************************* PP YABBY 162 hfPkihfgl 170 hfP+ihfgl Glyma.13G311200.7.p 100 HFPHIHFGL 108 *****97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	7.6E-43	2	108	IPR006780	YABBY protein
SuperFamily	SSF47095	1.03E-8	53	101	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	1.8E-5	56	102	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 132 aa Download sequence Send to blast
MGASLQTFPS QDTTQLQRQH LSVQEACSKE LGSSSKCKTF ETVDHDQQPR IPPIRPPEKR 60 QRVPSAYNRF IKEEIQRIKA SNPDISHREA FSTAAKNWAH FPHIHFGLKL DGNKQAKLDQ 120 GDGTQKSNGF Y*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Gma.9656	0.0	flower\| leaf\| pod\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo, expressed from the heart stage in the abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269\|PubMed:10457020}.
Uniprot	TISSUE SPECIFICITY: Expressed at low levels in abaxial regions of lateral aerial organ primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269\|PubMed:10457020}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.13G311200.7.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT095127	0.0	BT095127.1 Soybean clone JCVI-FLGm-6F4 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001344758.1	2e-95	protein YABBY 14
Refseq	XP_028190249.1	2e-95	putative axial regulator YABBY 2 isoform X2
Swissprot	Q9XFB0	5e-50	YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBL	A0A445ICH1	4e-94	A0A445ICH1_GLYSO; Putative axial regulator YABBY 2 isoform C
TrEMBL	I1M471	4e-94	I1M471_SOYBN; Uncharacterized protein
STRING	GLYMA13G38750.1	6e-95	(Glycine max)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08465.1	5e-44	YABBY family protein

Link Out ? help Back to Top
Phytozome	Glyma.13G311200.7.p
Entrez Gene	100815973

Publications ? help Back to Top
Sacharowski SP, et al. SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development. Plant Cell, 2015. 27(7): p. 1889-906 [PMID:26106148]