PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G256900.6.p
Common NameGLYMA_13G256900, LOC100818433
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MIKC_MADS
Protein Properties Length: 207aa    MW: 23794.7 Da    PI: 9.8337
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G256900.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.97.5e-25958150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         k+i++ + rqvtfskR+ g++KKA ELS LCdae+a+i+fs+ gkl++y 
  Glyma.13G256900.6.p  9 KKIDDVTARQVTFSKRKSGLFKKARELSLLCDAEIALIVFSPGGKLFDYG 58
                         689********************************************995 PP

2K-box454.5e-16871711599
                K-box  15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                          e+ + ++a L+ke     re R+l Ge+L+ L+l+eLq+Le++L++sl+++ + K e ++++i  l++k k+l e+n+ ++++++
  Glyma.13G256900.6.p  87 EQVRCNYADLNKEFADRTREMRQLNGEELQGLTLRELQKLEERLDSSLNRVYKAKVENFIKEIGILKEKGKKLMEDNMLIKQMIK 171
                          566778999999999999************************************************************9999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.5E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.315161IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-24323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002654.64E-37369No hitNo description
SuperFamilySSF554554.71E-29379IPR002100Transcription factor, MADS-box
PfamPF003192.1E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-243859IPR002100Transcription factor, MADS-box
PfamPF014864.4E-1586170IPR002487Transcription factor, K-box
PROSITE profilePS5129711.20486176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MVRRKIPIKK IDDVTARQVT FSKRKSGLFK KARELSLLCD AEIALIVFSP GGKLFDYGSS  60
SMQKVIERHI LRSELNLEKL DQSCPTEQVR CNYADLNKEF ADRTREMRQL NGEELQGLTL  120
RELQKLEERL DSSLNRVYKA KVENFIKEIG ILKEKGKKLM EDNMLIKQMI KLPRNEICSV  180
QRHEHEQGQL FDTSLTLGLP FPAGSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-19174174MEF2 CHIMERA
6byy_B2e-19174174MEF2 CHIMERA
6byy_C2e-19174174MEF2 CHIMERA
6byy_D2e-19174174MEF2 CHIMERA
6bz1_A2e-19174174MEF2 CHIMERA
6bz1_B2e-19174174MEF2 CHIMERA
6bz1_C2e-19174174MEF2 CHIMERA
6bz1_D2e-19174174MEF2 CHIMERA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.96460.0flower| pod
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During vegetative phase expressed in young leaves and apical meristem until early stage of bolting. Early in development of the inflorescence present in the coflorescence and flower primordia but not in the main apical meristem. Present throughout the floral meristem during early stages of flower development. Later disappears prior to emergence of sepal primordia. {ECO:0000269|PubMed:19656343}.
UniprotTISSUE SPECIFICITY: Detected in roots and leaves. Expressed at very low levels in flowers and siliques. Present in floral meristems. {ECO:0000269|PubMed:19656343}.
UniprotTISSUE SPECIFICITY: Widely expressed with highest levels in shoot tips and axillary buds. Also found in fully developed pedicels and flowers.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.
UniProtTranscription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G256900.6.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150382e-58AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006594670.11e-150MADS-box protein SVP isoform X1
RefseqXP_028188416.11e-150MADS-box protein SVP-like isoform X1
SwissprotQ9FUY62e-53JOIN_SOLLC; MADS-box protein JOINTLESS
SwissprotQ9FVC12e-53SVP_ARATH; MADS-box protein SVP
TrEMBLA0A0R0GU091e-148A0A0R0GU09_SOYBN; Uncharacterized protein
TrEMBLA0A445IA321e-148A0A445IA32_GLYSO; MADS-box protein SVP isoform A
STRINGGLYMA13G33031.11e-149(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.16e-50MIKC_MADS family protein
Publications ? help Back to Top
  1. Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP
    Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae).
    PLoS ONE, 2013. 8(6): p. e67243
    [PMID:23840638]
  2. Jaudal M, et al.
    Overexpression of Medicago SVP genes causes floral defects and delayed flowering in Arabidopsis but only affects floral development in Medicago.
    J. Exp. Bot., 2014. 65(2): p. 429-42
    [PMID:24249713]
  3. Müller-Xing R,Clarenz O,Pokorny L,Goodrich J,Schubert D
    Polycomb-Group Proteins and FLOWERING LOCUS T Maintain Commitment to Flowering in Arabidopsis thaliana.
    Plant Cell, 2014. 26(6): p. 2457-2471
    [PMID:24920331]
  4. Nakano T,Kato H,Shima Y,Ito Y
    Apple SVP Family MADS-Box Proteins and the Tomato Pedicel Abscission Zone Regulator JOINTLESS have Similar Molecular Activities.
    Plant Cell Physiol., 2015. 56(6): p. 1097-106
    [PMID:25746985]
  5. Hwan Lee J,Sook Chung K,Kim SK,Ahn JH
    Post-translational regulation of SHORT VEGETATIVE PHASE as a major mechanism for thermoregulation of flowering.
    Plant Signal Behav, 2014. 9(4): p. e28193
    [PMID:25764420]
  6. Chen Z, et al.
    Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar.
    Transgenic Res., 2015. 24(4): p. 705-15
    [PMID:25820621]
  7. Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG
    A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch].
    BMC Plant Biol., 2015. 15: p. 41
    [PMID:25848674]
  8. Müller-Xing R,Schubert D,Goodrich J
    Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(4): p. e1010868
    [PMID:25924005]
  9. Marín-González E, et al.
    SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures.
    Plant Physiol., 2015. 169(2): p. 1214-24
    [PMID:26243615]
  10. Bechtold U, et al.
    Time-Series Transcriptomics Reveals That AGAMOUS-LIKE22 Affects Primary Metabolism and Developmental Processes in Drought-Stressed Arabidopsis.
    Plant Cell, 2016. 28(2): p. 345-66
    [PMID:26842464]
  11. Fernández V,Takahashi Y,Le Gourrierec J,Coupland G
    Photoperiodic and thermosensory pathways interact through CONSTANS to promote flowering at high temperature under short days.
    Plant J., 2016. 86(5): p. 426-40
    [PMID:27117775]
  12. Wilson DC,Kempthorne CJ,Carella P,Liscombe DK,Cameron RK
    Age-Related Resistance in Arabidopsis thaliana Involves the MADS-Domain Transcription Factor SHORT VEGETATIVE PHASE and Direct Action of Salicylic Acid on Pseudomonas syringae.
    Mol. Plant Microbe Interact., 2017. 30(11): p. 919-929
    [PMID:28812948]
  13. Zou YP, et al.
    Adaptation of Arabidopsis thaliana to the Yangtze River basin.
    Genome Biol., 2017. 18(1): p. 239
    [PMID:29284515]
  14. Richter R, et al.
    Floral regulators FLC and SOC1 directly regulate expression of the B3-type transcription factor TARGET OF FLC AND SVP 1 at the Arabidopsis shoot apex via antagonistic chromatin modifications.
    PLoS Genet., 2019. 15(4): p. e1008065
    [PMID:30946745]