PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

MIKC_MADS

Protein Properties

Length: 205aa MW: 23297.1 Da PI: 9.5261

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.12G005000.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	79.1	3.1e-25	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien rqvtf+kRr+g+lKKA+ELSvLCdae+ + ifs +gklye + Glyma.12G005000.1.p 9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGLFIFSAHGKLYELA 58 79*********************************************965 PP
2	K-box	67.2	5.5e-23	91	173	17	99
K-box 17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ++e + Lk+ei++Lq+ +Rhl G + +++++ eLq Le++Le+ + +iRs K++++l++i+ l+ ke l+ +nk+L+ k+ Glyma.12G005000.1.p 91 AKEETNMLKQEIQTLQKGIRHLFGGGNKTMTIDELQVLEKNLETWIYHIRSMKMNIMLQEIQALKDKEGTLKAANKYLHDKIV 173 57999***************************************************************************996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	29.801	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	3.1E-35	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	8.5E-28	1	75	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.49E-40	2	78	No hit	No description
PRINTS	PR00404	3.0E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.7E-22	10	56	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.0E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.0E-27	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	11.748	88	178	IPR002487	Transcription factor, K-box
Pfam	PF01486	5.0E-22	91	172	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0048364	Biological Process	root development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 205 aa Download sequence Send to blast
MARGKVQLKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGLFIFSA HGKLYELATK 60 GTMQGLIERY MKFSRGAQPE AAPEAHPLLD AKEETNMLKQ EIQTLQKGIR HLFGGGNKTM 120 TIDELQVLEK NLETWIYHIR SMKMNIMLQE IQALKDKEGT LKAANKYLHD KIVENTAISN 180 FAQFATDTSN SYPLIIQDEV FQLY*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-16	1	93	1	92	MEF2C
5f28_B	1e-16	1	93	1	92	MEF2C
5f28_C	1e-16	1	93	1	92	MEF2C
5f28_D	1e-16	1	93	1	92	MEF2C
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During embryo development, expressed in a punctate pattern from the globular stage to the torpedo stage. {ECO:0000269\|PubMed:11855641}.
Uniprot	TISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). In root meristem, expressed in external cells of columella, lateral root cap and atrichoblasts. In mature root, expressed in the central cylinder (PubMed:11855641). Expressed in leaf vasculature, young floral meristems and nectaries (PubMed:18203871). {ECO:0000269\|PubMed:11855641, ECO:0000269\|PubMed:18203871, ECO:0000269\|PubMed:7549482}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269\|PubMed:18203871}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.12G005000.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin in root phloem. {ECO:0000269\|PubMed:18203871}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT099142	0.0	BT099142.1 Soybean clone JCVI-FLGm-16J2 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001242837.2	1e-151	agamous-like MADS-box protein AGL12-like protein
Refseq	XP_014619807.1	1e-151	agamous-like MADS-box protein AGL12-like protein isoform X1
Refseq	XP_028192307.1	1e-151	agamous-like MADS-box protein AGL12
Swissprot	Q38841	1e-78	AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBL	A0A0B2RDD5	1e-150	A0A0B2RDD5_GLYSO; Agamous-like MADS-box protein AGL12
TrEMBL	I1LNS4	1e-150	I1LNS4_SOYBN; Uncharacterized protein
STRING	GLYMA12G00770.1	1e-151	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF7566	31	44
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G71692.1	5e-81	AGAMOUS-like 12

Link Out ? help Back to Top
Phytozome	Glyma.12G005000.1.p
Entrez Gene	100783345

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Pacheco-Escobedo MA, et al. Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm. Ann. Bot., 2018. [PMID:27358290] García-Cruz KV, et al. The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components. Ann. Bot., 2018. [PMID:27474508]