PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.10G192000.4.p | ||||||||
Common Name | GLYMA_10G192000 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 122aa MW: 13399.1 Da PI: 5.2741 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 179.8 | 2.5e-56 | 27 | 119 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 reqdr+lPian+srimkk+lP n+ki+kdak+t+qecvsefisf+tseas+kcq+ekrktingddllwa+atlGfedy+eplkvyl++yr Glyma.10G192000.4.p 27 REQDRYLPIANISRIMKKALPPNGKIAKDAKDTMQECVSEFISFITSEASEKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYR 116 89**************************************************************************************** PP NF-YB 92 ele 94 e+e Glyma.10G192000.4.p 117 EAE 119 *98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.2E-53 | 26 | 119 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.1E-39 | 29 | 119 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-29 | 32 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.1E-21 | 60 | 78 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 63 | 79 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.1E-21 | 79 | 97 | No hit | No description |
PRINTS | PR00615 | 1.1E-21 | 98 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MSDAPASPSH ESGGEQSPRG SLSGAAREQD RYLPIANISR IMKKALPPNG KIAKDAKDTM 60 QECVSEFISF ITSEASEKCQ KEKRKTINGD DLLWAMATLG FEDYIEPLKV YLARYREAEV 120 S* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 6e-49 | 27 | 117 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 6e-49 | 27 | 117 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.19437 | 0.0 | cotyledon| flower| hypocotyl| leaf| pod| root| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. Predominantly expressed in leaves, flowers and siliques. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.10G192000.4.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FJ775529 | 0.0 | FJ775529.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1a) mRNA, complete cds. | |||
GenBank | FJ775530 | 0.0 | FJ775530.1 Glycine max CCAAT-binding transcription factor family protein (NF-YB1b) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001239681.1 | 3e-84 | nuclear transcription factor Y subunit B-8-like | ||||
Refseq | XP_006588494.1 | 3e-84 | nuclear transcription factor Y subunit B-8-like isoform X1 | ||||
Refseq | XP_028182182.1 | 3e-84 | nuclear transcription factor Y subunit B-1-like | ||||
Refseq | XP_028182183.1 | 3e-84 | nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | Q9SLG0 | 1e-65 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
TrEMBL | A0A0R0HVR2 | 2e-84 | A0A0R0HVR2_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA10G33550.2 | 1e-83 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.3 | 3e-68 | nuclear factor Y, subunit B1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.10G192000.4.p |